FHIR © HL7.org  |  Server Home  |  Health Intersections FHIR Server v1.0.262  |  FHIR Version 3.5.0  | User: ANONYMOUS (Unknown)  

History Record

XML or JSON representation

Links: First Previous Next Last  (1508 found). Search: http://test.fhir.org/r4/ValueSet/_history?&_prior=2018-10-20T16:54:26.218Z&_format=text/xhtml&history-id=9dfe103f-d9a8-48df-9d87-1364c4ebeb 

ValueSet "11" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

All Snomed codes that are subsumed by 404684003 (Clinical Finding)

{
  "resourceType" : "ValueSet",
  "id" : "11",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:47.671Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">All Snomed codes that are subsumed by 404684003 (Clinical Finding)</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/intensional-case-3",
  "identifier" : [
    {
      "value" : "intensional-case-3"
    }
  ],
  "name" : "Terminology Services Connectation #1 Intensional case #3",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "All Snomed codes that are subsumed by 404684003 (Clinical Finding)",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "404684003"
          }
        ]
      }
    ]
  }
}

ValueSet "10" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

All Snomed codes that are subsumed by 38341003 (Hypertensive disorder, systemic arterial)

{
  "resourceType" : "ValueSet",
  "id" : "10",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:47.328Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">All Snomed codes that are subsumed by 38341003 (Hypertensive disorder, systemic arterial)</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/intensional-case-2",
  "identifier" : [
    {
      "value" : "intensional-case-2"
    }
  ],
  "name" : "Terminology Services Connectation #1 Intensional case #2",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "All Snomed codes that are subsumed by 38341003 (Hypertensive disorder, systemic arterial)",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "38341003"
          }
        ]
      }
    ]
  }
}

ValueSet "9" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

All loinc codes for system = Arterial system

{
  "resourceType" : "ValueSet",
  "id" : "9",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:46.906Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">All loinc codes for system = Arterial system</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/intensional-case-1",
  "identifier" : [
    {
      "value" : "intensional-case-1"
    }
  ],
  "name" : "Terminology Services Connectation #1 Intensional case #1",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "All loinc codes for system = Arterial system",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "SYSTEM",
            "op" : "=",
            "value" : "Arterial system"
          }
        ]
      }
    ]
  }
}

ValueSet "8" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

A selection of codes from http://hl7.org/fhir/administrative-gender

{
  "resourceType" : "ValueSet",
  "id" : "8",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:46.156Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">A selection of codes from http://hl7.org/fhir/administrative-gender</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/extensional-case-4",
  "identifier" : [
    {
      "value" : "extensional-case-4"
    }
  ],
  "name" : "Terminology Services Connectation #1 Extensional case #4",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "A mixed enumeration of codes from FHIR, and from V2 administrative gender code",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/administrative-gender",
        "concept" : [
          {
            "code" : "male",
            "display" : "Male"
          },
          {
            "code" : "female",
            "display" : "Female"
          },
          {
            "code" : "other",
            "display" : "Other"
          },
          {
            "code" : "unknown",
            "display" : "Unknown"
          }
        ]
      },
      {
        "system" : "http://hl7.org/fhir/v2/0001",
        "concept" : [
          {
            "code" : "A",
            "display" : "Ambiguous"
          },
          {
            "code" : "F",
            "display" : "Female"
          },
          {
            "code" : "M",
            "display" : "Male"
          },
          {
            "code" : "N",
            "display" : "Not applicable"
          },
          {
            "code" : "O",
            "display" : "Other"
          },
          {
            "code" : "U",
            "display" : "Unknown"
          }
        ]
      }
    ]
  }
}

ValueSet "7" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

A selection of codes from http://snomed.info/sct

{
  "resourceType" : "ValueSet",
  "id" : "7",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:44.796Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">A selection of codes from http://snomed.info/sct</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/extensional-case-3",
  "identifier" : [
    {
      "value" : "extensional-case-3"
    }
  ],
  "name" : "Terminology Services Connectation #1 Extensional case #3",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "an enumeration of codes defined by SNOMED",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "concept" : [
          {
            "code" : "371037005",
            "display" : "Systolic dysfunction"
          },
          {
            "code" : "56218007",
            "display" : "Systolic hypertension"
          },
          {
            "code" : "271657009",
            "display" : "Systolic cardiac thrill"
          },
          {
            "code" : "429457004",
            "display" : "Systolic essential hypertension"
          },
          {
            "code" : "417996009",
            "display" : "Systolic heart failure"
          },
          {
            "code" : "44623008",
            "display" : "Systolic ejection sound"
          },
          {
            "code" : "248677002",
            "display" : "Systolic flow murmur"
          },
          {
            "code" : "31574009",
            "display" : "Systolic murmur"
          },
          {
            "code" : "120871000119108",
            "display" : "Systolic heart failure stage B"
          },
          {
            "code" : "120851000119104",
            "display" : "Systolic heart failure stage D"
          },
          {
            "code" : "120861000119102",
            "display" : "Systolic heart failure stage C"
          },
          {
            "code" : "609556008",
            "display" : "Systolic heart failure stage A"
          },
          {
            "code" : "61926008",
            "display" : "Basal systolic thrill"
          },
          {
            "code" : "248672008",
            "display" : "Soft systolic murmur"
          },
          {
            "code" : "65254001",
            "display" : "Late systolic murmur"
          },
          {
            "code" : "89985004",
            "display" : "Early systolic murmur"
          },
          {
            "code" : "248692001",
            "display" : "Mid-systolic click"
          },
          {
            "code" : "248678007",
            "display" : "Mitral late systolic murmur"
          },
          {
            "code" : "443254009",
            "display" : "Acute systolic heart failure"
          },
          {
            "code" : "441481004",
            "display" : "Chronic systolic heart failure"
          },
          {
            "code" : "48965007",
            "display" : "Single non-ejection systolic click"
          },
          {
            "code" : "68519006",
            "display" : "Multiple non-ejection systolic clicks"
          },
          {
            "code" : "134401001",
            "display" : "Left ventricular systolic dysfunction"
          },
          {
            "code" : "416158002",
            "display" : "Right ventricular systolic dysfunction"
          },
          {
            "code" : "68494000",
            "display" : "Mid-systolic murmur"
          },
          {
            "code" : "442304009",
            "display" : "Combined systolic and diastolic dysfunction"
          },
          {
            "code" : "18352002",
            "display" : "Abnormal systolic arterial pressure"
          },
          {
            "code" : "407596008",
            "display" : "Echocardiogram shows left ventricular systolic dysfunction"
          },
          {
            "code" : "371857005",
            "display" : "Normal left ventricular systolic function and wall motion"
          },
          {
            "code" : "430396006",
            "display" : "Chronic systolic dysfunction of left ventricle"
          },
          {
            "code" : "12929001",
            "display" : "Normal systolic arterial pressure"
          },
          {
            "code" : "275285009",
            "display" : "On examination - systolic murmur"
          },
          {
            "code" : "443253003",
            "display" : "Acute on chronic systolic heart failure"
          },
          {
            "code" : "371862006",
            "display" : "Depression of left ventricular systolic function"
          },
          {
            "code" : "81010002",
            "display" : "Decreased systolic arterial pressure"
          },
          {
            "code" : "163030003",
            "display" : "On examination - Systolic BP reading"
          },
          {
            "code" : "163069009",
            "display" : "On examination - systolic cardiac thrill"
          },
          {
            "code" : "18050000",
            "display" : "Increased systolic arterial pressure"
          },
          {
            "code" : "163094005",
            "display" : "On examination - pulmonary systolic murmur"
          },
          {
            "code" : "426263006",
            "display" : "Congestive heart failure due to left ventricular systolic dysfunction"
          },
          {
            "code" : "417081007",
            "display" : "Systolic anterior movement of mitral valve"
          },
          {
            "code" : "248679004",
            "display" : "Mitral pansystolic murmur"
          },
          {
            "code" : "248687003",
            "display" : "Presystolic mitral murmur"
          },
          {
            "code" : "248688008",
            "display" : "Presystolic tricuspid murmur"
          },
          {
            "code" : "71201008",
            "display" : "Pansystolic murmur"
          },
          {
            "code" : "23795000",
            "display" : "Presystolic murmur"
          },
          {
            "code" : "23795000",
            "display" : "Presystolic murmur"
          },
          {
            "code" : "248680001",
            "display" : "Tricuspid inspiratory pansystolic murmur"
          },
          {
            "code" : "248681002",
            "display" : "Left parasternal pansystolic murmur"
          }
        ]
      }
    ]
  }
}

ValueSet "6" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

A selection of codes from http://loinc.org

{
  "resourceType" : "ValueSet",
  "id" : "6",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:44.000Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">A selection of codes from http://loinc.org</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/extensional-case-2",
  "identifier" : [
    {
      "value" : "extensional-case-2"
    }
  ],
  "name" : "Terminology Services Connectation #1 Extensional case #2",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "an enumeration of codes defined by LOINC",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "concept" : [
          {
            "code" : "11378-7",
            "display" : "Systolic blood pressure at First encounter"
          },
          {
            "code" : "8493-9",
            "display" : "Systolic blood pressure 10 hour minimum"
          },
          {
            "code" : "8494-7",
            "display" : "Systolic blood pressure 12 hour minimum"
          },
          {
            "code" : "8495-4",
            "display" : "Systolic blood pressure 24 hour minimum"
          },
          {
            "code" : "8450-9",
            "display" : "Systolic blood pressure--expiration"
          },
          {
            "code" : "8451-7",
            "display" : "Systolic blood pressure--inspiration"
          },
          {
            "code" : "8452-5",
            "display" : "Systolic blood pressure.inspiration - expiration"
          },
          {
            "code" : "8459-0",
            "display" : "Systolic blood pressure--sitting"
          },
          {
            "code" : "8460-8",
            "display" : "Systolic blood pressure--standing"
          },
          {
            "code" : "8461-6",
            "display" : "Systolic blood pressure--supine"
          },
          {
            "code" : "8479-8",
            "display" : "Systolic blood pressure by palpation"
          },
          {
            "code" : "8480-6",
            "display" : "Systolic blood pressure"
          },
          {
            "code" : "8481-4",
            "display" : "Systolic blood pressure 1 hour maximum"
          },
          {
            "code" : "8482-2",
            "display" : "Systolic blood pressure 8 hour maximum"
          },
          {
            "code" : "8483-0",
            "display" : "Systolic blood pressure 10 hour maximum"
          },
          {
            "code" : "8484-8",
            "display" : "Systolic blood pressure 12 hour maximum"
          },
          {
            "code" : "8485-5",
            "display" : "Systolic blood pressure 24 hour maximum"
          },
          {
            "code" : "8486-3",
            "display" : "Systolic blood pressure 1 hour mean"
          },
          {
            "code" : "8487-1",
            "display" : "Systolic blood pressure 8 hour mean"
          },
          {
            "code" : "8488-9",
            "display" : "Systolic blood pressure 10 hour mean"
          },
          {
            "code" : "8489-7",
            "display" : "Systolic blood pressure 12 hour mean"
          },
          {
            "code" : "8490-5",
            "display" : "Systolic blood pressure 24 hour mean"
          },
          {
            "code" : "8491-3",
            "display" : "Systolic blood pressure 1 hour minimum"
          },
          {
            "code" : "8492-1",
            "display" : "Systolic blood pressure 8 hour minimum"
          }
        ]
      }
    ]
  }
}

ValueSet "5" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

A selection of codes from http://hl7.org/fhir/administrative-gender

{
  "resourceType" : "ValueSet",
  "id" : "5",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-30T21:19:42.874Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">A selection of codes from http://hl7.org/fhir/administrative-gender</div>"
  },
  "url" : "http://www.healthintersections.com.au/fhir/ValueSet/extensional-case-1",
  "identifier" : [
    {
      "value" : "extensional-case-1"
    }
  ],
  "name" : "Terminology Services Connectation #1 Extensional case #1",
  "status" : "active",
  "experimental" : true,
  "publisher" : "Grahame Grieve",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "grahame@healthintersections.com.au"
        }
      ]
    }
  ],
  "description" : "an enumeration of codes defined by FHIR itself",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/administrative-gender",
        "concept" : [
          {
            "code" : "male",
            "display" : "Male"
          },
          {
            "code" : "female",
            "display" : "Female"
          },
          {
            "code" : "other",
            "display" : "Other"
          },
          {
            "code" : "unknown",
            "display" : "Unknown"
          }
        ]
      }
    ]
  }
}

ValueSet "4" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by


{
  "resourceType" : "ValueSet",
  "id" : "4",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-07T20:21:14.890Z"
  },
  "url" : "http://fhir.org/guides/cdc/opioid-cds/non-narc_scr_urine_loinc",
  "identifier" : [
    {
      "value" : "non-narc_scr_urine_loinc"
    }
  ],
  "version" : "1",
  "name" : "Non-opioid drug urine tests",
  "status" : "draft",
  "experimental" : false,
  "publisher" : "MD Partners, Inc.",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "info@mdpartners.com"
        }
      ]
    }
  ],
  "description" : "General screening tests in urine for controlled drugs and drugs of abuse other than narcotics. Excluding narcotic drug tests.",
  "copyright" : "This content LOINC is copyright © 1995 Regenstrief Institute, Inc. and the LOINC Committee, and available at no cost under the license at http://loinc.org/terms-of-use",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "LP31448-1"
          },
          {
            "property" : "SYSTEM",
            "op" : "=",
            "value" : "Urine"
          }
        ]
      }
    ],
    "exclude" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "LP18149-2"
          }
        ]
      }
    ]
  }
}

ValueSet "3" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by


{
  "resourceType" : "ValueSet",
  "id" : "3",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-07T19:44:58.000Z"
  },
  "url" : "http://fhir.org/guides/cdc/opioid-cds/non-opioid_scr_urine_loinc",
  "identifier" : [
    {
      "value" : "non-opioid_scr_urine_loinc"
    }
  ],
  "version" : "1",
  "name" : "Non-opioid drug urine tests",
  "status" : "draft",
  "experimental" : false,
  "publisher" : "MD Partners, Inc.",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "info@mdpartners.com"
        }
      ]
    }
  ],
  "description" : "General screening tests in urine for controlled drugs and drugs of abuse other than narcotics. Excluding narcotic drug tests.",
  "copyright" : "This content LOINC is copyright © 1995 Regenstrief Institute, Inc. and the LOINC Committee, and available at no cost under the license at http://loinc.org/terms-of-use",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "LP31448-1"
          },
          {
            "property" : "SYSTEM",
            "op" : "=",
            "value" : "Urine"
          },
          {
            "property" : "concept",
            "op" : "is-not-a",
            "value" : "LP18149-2"
          }
        ]
      }
    ]
  }
}

ValueSet "2" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by


{
  "resourceType" : "ValueSet",
  "id" : "2",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-07T19:00:17.281Z"
  },
  "url" : "http://fhir.org/guides/cdc/opioid-cds/opioid_scr_urine_loinc",
  "identifier" : [
    {
      "value" : "opioid_scr_urine_loinc"
    }
  ],
  "version" : "1.1",
  "name" : "Opioid drug urine test",
  "status" : "draft",
  "experimental" : false,
  "publisher" : "MD Partners, Inc.",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "info@mdpartners.com"
        }
      ]
    }
  ],
  "description" : "General screening tests for narcotic and opioids in urine. Excluding non-narcotic drugs.",
  "copyright" : "This content LOINC is copyright © 1995 Regenstrief Institute, Inc. and the LOINC Committee, and available at no cost under the license at http://loinc.org/terms-of-use",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "LP18149-2"
          },
          {
            "property" : "SYSTEM",
            "op" : "=",
            "value" : "Urine"
          }
        ]
      }
    ]
  }
}

ValueSet "1" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by


{
  "resourceType" : "ValueSet",
  "id" : "1",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-07T17:13:19.140Z"
  },
  "url" : "http://fhir.org/guides/cdc/opioid-cds/opioid_scr_urine_loinc",
  "identifier" : [
    {
      "value" : "opioid_scr_urine_loinc"
    }
  ],
  "version" : "1",
  "name" : "Opioid drug urine test",
  "status" : "draft",
  "experimental" : false,
  "publisher" : "MD Partners, Inc.",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "email",
          "value" : "info@mdpartners.com"
        }
      ]
    }
  ],
  "description" : "General screening tests for narcotic and opioids in urine. Excluding non-narcotic drugs.",
  "copyright" : "This content LOINC is copyright © 1995 Regenstrief Institute, Inc. and the LOINC Committee, and available at no cost under the license at http://loinc.org/terms-of-use",
  "compose" : {
    "include" : [
      {
        "system" : "http://loinc.org",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "LP18149-2"
          },
          {
            "property" : "System",
            "op" : "=",
            "value" : "Urine"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-substance" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Substance-Reactant for Intolerance and Negation Codes

A substance or other type of agent (e.g., sunshine) that may be associated with an intolerance reaction event or a propensity to such an event. These concepts are expected to be at a more general level of abstraction (ingredients versus more specific formulations). This value set is quite general and includes concepts that may never cause an adverse event, particularly the included SNOMED CT concepts. The code system-specific value sets in this grouping value set are intended to provide broad coverage of all kinds of agents, but the expectation for use is that the chosen concept identifier for a substance should be appropriately specific and drawn from the available code systems in the following priority order: 1. NDF-RT codes for drug class allergies 2. RxNorm codes limited to term types (TTY) , 'BN' Brand Name, 'IN' ingredient, 'MIN' multiple ingredient, and 'PIN' precise ingredient for drug ingredient allergies 3. SNOMED CT including concepts from SCTID 716186003 No Known allergy (situation) and if no other code from above code systems are available

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-substance",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.749Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Substance-Reactant for Intolerance and Negation Codes</h2><div><p>A substance or other type of agent (e.g., sunshine) that may be associated with an intolerance reaction event or a propensity to such an event. These concepts are expected to be at a more general level of abstraction (ingredients versus more specific formulations). This value set is quite general and includes concepts that may never cause an adverse event, particularly the included SNOMED CT concepts. The code system-specific value sets in this grouping value set are intended to provide broad coverage of all kinds of agents, but the expectation for use is that the chosen concept identifier for a substance should be appropriately specific and drawn from the available code systems in the following priority order: 1. NDF-RT codes for drug class allergies 2. RxNorm codes limited to term types (TTY) , 'BN' Brand Name, 'IN' ingredient, 'MIN' multiple ingredient, and 'PIN' precise ingredient for drug ingredient allergies 3. SNOMED CT including concepts from SCTID 716186003 No Known allergy (situation) and if no other code from above code systems are available</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement</p><p>This value set includes codes from the following code systems:</p><ul><li>Import all the codes that are contained in <a href=\"ValueSet-us-core-substance-ndfrt.html\">http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-ndfrt</a></li><li>Import all the codes that are contained in <a href=\"ValueSet-us-core-substance-rxnorm.html\">http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-rxnorm</a></li><li>Import all the codes that are contained in <a href=\"ValueSet-us-core-substance-sct.html\">http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-sct</a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance",
  "version" : "2.0.0",
  "name" : "US Core Substance-Reactant for Intolerance and Negation Codes",
  "status" : "draft",
  "date" : "2016-05-25T16:59:08+10:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "A substance or other type of agent (e.g., sunshine) that may be associated with an intolerance reaction event or a propensity to such an event. These concepts are expected to be at a more general level of abstraction (ingredients versus more specific formulations). This value set is quite general and includes concepts that may never cause an adverse event, particularly the included SNOMED CT concepts. The code system-specific value sets in this grouping value set are intended to provide broad coverage of all kinds of agents, but the expectation for use is that the chosen concept identifier for a substance should be appropriately specific and drawn from the available code systems in the following priority order: 1. NDF-RT codes for drug class allergies 2. RxNorm codes limited to term types (TTY) , 'BN' Brand Name, 'IN' ingredient, 'MIN' multiple ingredient, and 'PIN' precise ingredient for drug ingredient allergies 3. SNOMED CT including concepts from SCTID 716186003 No Known allergy (situation) and if no other code from above code systems are available ",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement",
  "compose" : {
    "include" : [
      {
        "valueSet" : [
          "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-ndfrt"
        ]
      },
      {
        "valueSet" : [
          "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-rxnorm"
        ]
      },
      {
        "valueSet" : [
          "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-sct"
        ]
      }
    ]
  }
}

ValueSet "us-core-substance-sct" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core SNOMED CT Substances Other Than Clinical Drugs

SNOMED CT concepts from SCTID 716186003 No Known allergy (situation) and substance concepts Other Than Clinical Drug Substances that are not represented by RXNORM drug concepts or FDA UNII substance concepts. This value set is meant to be quite broad and includes many substances that may never be prescribed or be a reactant. It does not remove all overlap with RXNORM and UNII; for those concepts, the alternative code system should be chosen.

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-substance-sct",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.718Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core SNOMED CT Substances Other Than Clinical Drugs</h2><div><p>SNOMED CT concepts from SCTID 716186003 No Known allergy (situation) and substance concepts Other Than Clinical Drug Substances that are not represented by RXNORM drug concepts or FDA UNII substance concepts. This value set is meant to be quite broad and includes many substances that may never be prescribed or be a reactant. It does not remove all overlap with RXNORM and UNII; for those concepts, the alternative code system should be chosen.</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement.</p><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 716186003 (No known allergy (situation))</li><li>Include codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 105590001 (Substance)</li><li>Exclude codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 410942007 (Drug or medicament (substance))</li><li>Exclude codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 438951008 (Substance categorized by hazard characteristics (substance))</li><li>Exclude codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 312412007 (Substance categorized functionally)</li><li>Exclude codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 312413002 (Substance categorized structurally)</li><li>Exclude codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 312417001 (Substance of abuse)</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-sct",
  "version" : "2.0.0",
  "name" : "US Core SNOMED CT Substances Other Than Clinical Drugs",
  "status" : "draft",
  "date" : "2016-12-02",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "SNOMED CT concepts from SCTID 716186003 No Known allergy (situation) and substance concepts Other Than Clinical Drug Substances that are not represented by RXNORM drug concepts or FDA UNII substance concepts. This value set is meant to be quite broad and includes many substances that may never be prescribed or be a reactant. It does not remove all overlap with RXNORM and UNII; for those concepts, the alternative code system should be chosen.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement.",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "716186003"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "105590001"
          }
        ]
      }
    ],
    "exclude" : [
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "410942007"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "438951008"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "312412007"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "312413002"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "312417001"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-substance-rxnorm" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Substance RxNorm Codes

All RxNorm codes that have TTY = IN,PIN,MIN,BN, but TTY != OCD.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-substance-rxnorm",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.671Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Substance RxNorm Codes</h2><div><p>All RxNorm codes that have TTY = IN,PIN,MIN,BN, but TTY != OCD.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <a href=\"http://www.nlm.nih.gov/research/umls/rxnorm\"><code>http://www.nlm.nih.gov/research/umls/rxnorm</code></a> where TTY in IN,PIN,MIN,BN</li><li>Exclude codes from <a href=\"http://www.nlm.nih.gov/research/umls/rxnorm\"><code>http://www.nlm.nih.gov/research/umls/rxnorm</code></a> where TTY = OCD</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-rxnorm",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113762.1.4.1010.7"
    }
  ],
  "version" : "2.0.0",
  "name" : "US Core Substance RxNorm Codes",
  "status" : "draft",
  "date" : "2018-08-21T01:46:22+00:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "All RxNorm codes that have TTY = IN,PIN,MIN,BN, but TTY != OCD.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "http://www.nlm.nih.gov/research/umls/rxnorm",
        "filter" : [
          {
            "property" : "TTY",
            "op" : "in",
            "value" : "IN,PIN,MIN,BN"
          }
        ]
      }
    ],
    "exclude" : [
      {
        "system" : "http://www.nlm.nih.gov/research/umls/rxnorm",
        "filter" : [
          {
            "property" : "TTY",
            "op" : "=",
            "value" : "OCD"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-substance-ndfrt" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Substance ND-FRT codes

All ND-FRT NUIs for concepts that are subsumed by 'Mechanism of Action - N0000000223', 'Physiologic Effect - N0000009802' or 'Chemical Structure - N0000000002'.

This value set includes codes from the following code systems:

  • Include codes from http://hl7.org/fhir/ndfrt where concept is-a N0000000223
  • Include codes from http://hl7.org/fhir/ndfrt where concept is-a N0000009802
  • Include codes from http://hl7.org/fhir/ndfrt where concept is-a N0000000002

{
  "resourceType" : "ValueSet",
  "id" : "us-core-substance-ndfrt",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.624Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Substance ND-FRT codes</h2><div><p>All ND-FRT NUIs for concepts that are subsumed by 'Mechanism of Action - N0000000223', 'Physiologic Effect - N0000009802' or 'Chemical Structure - N0000000002'.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <code>http://hl7.org/fhir/ndfrt</code> where concept is-a N0000000223</li><li>Include codes from <code>http://hl7.org/fhir/ndfrt</code> where concept is-a N0000009802</li><li>Include codes from <code>http://hl7.org/fhir/ndfrt</code> where concept is-a N0000000002</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-substance-ndfrt",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.3.88.12.80.18"
    }
  ],
  "version" : "2.0.0",
  "name" : "US Core Substance ND-FRT codes",
  "status" : "draft",
  "date" : "2018-08-21T01:46:22+00:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "All ND-FRT NUIs for concepts that are subsumed by 'Mechanism of Action - N0000000223', 'Physiologic Effect - N0000009802' or 'Chemical Structure - N0000000002'.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/ndfrt",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "N0000000223"
          }
        ]
      },
      {
        "system" : "http://hl7.org/fhir/ndfrt",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "N0000009802"
          }
        ]
      },
      {
        "system" : "http://hl7.org/fhir/ndfrt",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "N0000000002"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-provider-specialty" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Provider Speciality (NUCC)

Provider speciality roles codes which are composed of the NUCC Health Care Provider Taxonomy Code Set for providers

Copyright Statement: This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright © 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.

This value set includes codes from the following code systems:

  • Include all codes defined in http://nucc.org/provider-taxonomy

{
  "resourceType" : "ValueSet",
  "id" : "us-core-provider-specialty",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.577Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Provider Speciality (NUCC)</h2><div><p>Provider speciality roles codes which are composed of the NUCC Health Care Provider Taxonomy Code Set for providers</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright &#169; 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.</p><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://nucc.org/provider-taxonomy</code></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-provider-specialty",
  "version" : "2.0.0",
  "name" : "US Core Provider Speciality (NUCC)",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Provider speciality roles codes which are composed of the NUCC Health Care Provider Taxonomy Code Set for providers",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright © 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.",
  "compose" : {
    "include" : [
      {
        "system" : "http://nucc.org/provider-taxonomy"
      }
    ]
  }
}

ValueSet "us-core-provider-role" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Provider Role (NUCC)

Provider roles codes which are composed of the NUCC Health Care Provider Taxonomy Code Set for providers. Only concepts with a classification and no specialization are included.

Copyright Statement: TODO: Permission to Use and Distribute the Health Care Provider Taxonomy Code Set

This value set includes codes from the following code systems:

  • Include only concepts with a classification and no specialization from: http://nucc.org/provider-taxonomy

{
  "resourceType" : "ValueSet",
  "id" : "us-core-provider-role",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.531Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">\n&#9;&#9;&#9;<h2>US Core Provider Role (NUCC)</h2>\n&#9;&#9;&#9;<div>\n&#9;&#9;&#9;&#9;<p>Provider roles codes which are composed of the NUCC Health Care Provider Taxonomy\n&#9;&#9;&#9;&#9;&#9;Code Set for providers. Only concepts with a classification and no specialization are included.</p>\n&#9;&#9;&#9;</div>\n&#9;&#9;&#9;<p>\n&#9;&#9;&#9;&#9;<b>Copyright Statement:</b> TODO: Permission to Use and Distribute the Health Care\n&#9;&#9;&#9;&#9;Provider Taxonomy Code Set</p>\n&#9;&#9;&#9;<p>This value set includes codes from the following code systems:</p>\n&#9;&#9;&#9;<ul>\n&#9;&#9;&#9;&#9;<li>Include only concepts with a classification and no specialization from: http://nucc.org/provider-taxonomy</li>\n&#9;&#9;&#9;</ul>\n&#9;&#9;</div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-provider-role",
  "version" : "2.0.0",
  "name" : "US Core Provider Role (NUCC)",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Provider roles codes which are composed of the NUCC Health Care Provider Taxonomy Code Set classification codes for providers. Only concepts with a classification and no specialization are included. ",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright © 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.",
  "compose" : {
    "include" : [
      {
        "system" : "http://nucc.org/provider-taxonomy"
      }
    ]
  }
}

ValueSet "us-core-procedure-icd10pcs" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core ICD-10-PCS Procedure Codes

This value set defines a set of codes from ICD10-PCS that can be used to indicate a type of procedure performed

Copyright Statement: The International Classification of Diseases, Tenth Revision, Procedure Coding System (ICD-10-PCS) was developed for the Centers for Medicare and Medicaid Services (CMS). CMS is the U.S. governmental agency responsible for overseeing all changes and modifications to the ICD-10-PCS.

This value set includes codes from the following code systems:

  • Include all codes defined in http://www.icd10data.com/icd10pcs

{
  "resourceType" : "ValueSet",
  "id" : "us-core-procedure-icd10pcs",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.484Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core ICD-10-PCS Procedure Codes</h2><div><p>This value set defines a set of codes from ICD10-PCS that can be used to indicate a type of procedure performed</p>\n</div><p><b>Copyright Statement:</b> The International Classification of Diseases, Tenth Revision, Procedure Coding System (ICD-10-PCS) was developed for the Centers for Medicare and Medicaid Services (CMS). CMS is the U.S. governmental agency responsible for overseeing all changes and modifications to the ICD-10-PCS.</p><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://www.icd10data.com/icd10pcs</code></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-procedure-icd10pcs",
  "version" : "2.0.0",
  "name" : "US Core ICD-10-PCS Procedure Codes",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes from ICD10-PCS that can be used to indicate a type of procedure performed",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "The International Classification of Diseases, Tenth Revision, Procedure Coding System (ICD-10-PCS) was developed for the Centers for Medicare and Medicaid Services (CMS). CMS is the U.S. governmental agency responsible for overseeing all changes and modifications to the ICD-10-PCS.",
  "compose" : {
    "include" : [
      {
        "system" : "http://www.icd10data.com/icd10pcs"
      }
    ]
  }
}

ValueSet "us-core-procedure-code" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Procedure Codes

This example value set defines a set of codes that can be used to indicate the type of procedure: a specific code indicating type of procedure performed, from CPT or SNOMED CT.

Copyright Statement: CPT copyright 2014 American Medical Association. All rights reserved. This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement

This value set includes codes from the following code systems:

  • Include all codes defined in http://www.ama-assn.org/go/cpt
  • Include codes from http://snomed.info/sct where concept is-a 71388002 (Procedure)

{
  "resourceType" : "ValueSet",
  "id" : "us-core-procedure-code",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.437Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Procedure Codes</h2><div><p>This example value set defines a set of codes that can be used to indicate the type of procedure: a specific code indicating type of procedure performed, from CPT or SNOMED CT.</p>\n</div><p><b>Copyright Statement:</b> CPT copyright 2014 American Medical Association. All rights reserved. This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement</p><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://www.ama-assn.org/go/cpt</code></li><li>Include codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 71388002 (Procedure)</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-procedure-code",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.4.642.2.607"
    }
  ],
  "version" : "2.0.0",
  "name" : "US Core Procedure Codes",
  "status" : "draft",
  "date" : "2016-05-25T16:59:08+10:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This example value set defines a set of codes that can be used to indicate the type of procedure: a specific code indicating type of procedure performed, from CPT or SNOMED CT.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "CPT copyright 2014 American Medical Association. All rights reserved. This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement",
  "compose" : {
    "include" : [
      {
        "system" : "http://www.ama-assn.org/go/cpt"
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "71388002"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-problem" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Problem Value Set

This describes the problem. Diagnosis/Problem List is broadly defined as a series of brief statements that catalog a patient's medical, nursing, dental, social, preventative and psychiatric events and issues that are relevant to that patient's healthcare (e.g., signs, symptoms, and defined conditions)

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement

This value set includes codes from the following code systems:

  • No current problems or disability 160245001
  • Include codes from http://snomed.info/sct where concept is-a 404684003
  • Include codes from http://snomed.info/sct where concept is-a 243796009

{
  "resourceType" : "ValueSet",
  "id" : "us-core-problem",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.390Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">\n <h2>Problem Value Set</h2>\n <p>This describes the problem. Diagnosis/Problem List is broadly defined as a series of brief statements that catalog a patient's medical, nursing, dental, social, preventative and psychiatric events and issues that are relevant to that patient's healthcare (e.g., signs, symptoms, and defined conditions)</p>\n <p>\n <b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement\n </p>\n <p>This value set includes codes from the following code systems:</p>\n <ul>\n <li>No current problems or disability 160245001</li>\n <li>Include codes from http://snomed.info/sct where concept is-a 404684003</li>\n <li>Include codes from http://snomed.info/sct where concept is-a 243796009</li>\n </ul>\n </div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-problem",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.3.88.12.3221.7.4"
    }
  ],
  "version" : "2.0.0",
  "name" : "Problem Value Set",
  "status" : "active",
  "date" : "2016-05-25T16:59:08+10:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://phinvads.cdc.gov/vads/ViewValueSet.action?oid=2.16.840.1.113883.3.88.12.3221.7.4"
        }
      ]
    }
  ],
  "description" : "This describes the problem. Diagnosis/Problem List is broadly defined as a series of brief statements that catalog a patient's medical, nursing, dental, social, preventative and psychiatric events and issues that are relevant to that patient's healthcare (e.g., signs, symptoms, and defined conditions)",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "concept" : [
          {
            "code" : "160245001"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "404684003"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "243796009"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-observation-value-codes" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Observation Value Codes (SNOMED-CT)

Snomed-CT concept codes for coded results

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-observation-value-codes",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.343Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Observation Value Codes (SNOMED-CT)</h2><div><p><a href=\"http://www.ihtsdo.org/\">Snomed-CT</a> concept codes for coded results</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement</p><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-observation-value-codes",
  "version" : "2.0.0",
  "name" : "Observation Value Codes (SNOMED-CT)",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        },
        {
          "system" : "email",
          "value" : "fhir@lists.hl7.org"
        }
      ]
    }
  ],
  "description" : "[Snomed-CT](http://www.ihtsdo.org/) concept codes for coded results",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct"
      }
    ]
  }
}

ValueSet "us-core-observation-ccdasmokingstatus" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Smoking Status

This value set indicates the current smoking status of a patient.

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-observation-ccdasmokingstatus",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.296Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Smoking Status</h2><div><p>This value set indicates the current smoking status of a patient.</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement</p><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=449868002\">449868002</a></td><td>Current every day smoker</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=428041000124106\">428041000124106</a></td><td>Current some day smoker</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=8517006\">8517006</a></td><td>Former smoker</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=266919005\">266919005</a></td><td>Never smoker</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=77176002\">77176002</a></td><td>Smoker, current status unknown</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=266927001\">266927001</a></td><td>Unknown if ever smoked</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=428071000124103\">428071000124103</a></td><td>Current Heavy tobacco smoker</td><td/></tr><tr><td><a href=\"http://browser.ihtsdotools.org/?perspective=full&amp;conceptId1=428061000124105\">428061000124105</a></td><td>Current Light tobacco smoker</td><td/></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-observation-ccdasmokingstatus",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.4.642.2.602"
    }
  ],
  "version" : "2.0.0",
  "name" : "Smoking Status",
  "status" : "active",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set indicates the current smoking status of a patient.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement",
  "compose" : {
    "include" : [
      {
        "system" : "http://snomed.info/sct",
        "concept" : [
          {
            "code" : "449868002",
            "display" : "Current every day smoker"
          },
          {
            "code" : "428041000124106",
            "display" : "Current some day smoker"
          },
          {
            "code" : "8517006",
            "display" : "Former smoker"
          },
          {
            "code" : "266919005",
            "display" : "Never smoker"
          },
          {
            "code" : "77176002",
            "display" : "Smoker, current status unknown"
          },
          {
            "code" : "266927001",
            "display" : "Unknown if ever smoked"
          },
          {
            "code" : "428071000124103",
            "display" : "Current Heavy tobacco smoker"
          },
          {
            "code" : "428061000124105",
            "display" : "Current Light tobacco smoker"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-ndc-vaccine-codes" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Vaccine National Drug Code (NDC)

This value set includes all the Vaccine National Drug Codes (NDC). This source of this data is provided by the [CDC] (https://www2a.cdc.gov/vaccines/iis/iisstandards/ndc_crosswalk.asp)

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/sid/ndc
    CodeDisplay
    49281-0589-58Menactra
    49281-0623-78FLUZONE QUADRIVALENT
    49281-0515-00Fluzone Quadrivalent, peds
    49281-0415-88Fluzone Quadrivalent PF
    49281-0415-58FLUZONE QUADRIVALENT PF
    33332-0115-11AFLURIA
    33332-0015-02AFLURIA
    66019-0302-01FluMist Quadrivalent
    42874-0015-01Flublok
    66521-0118-12Fluvirin
    66521-0118-11Fluvirin
    58160-0883-41FLUARIX
    66521-0000-11Fluad
    69401-0000-01Vivotif
    66019-0301-01FluMist Quadrivalent
    33332-0014-02AFLURIA
    33332-0114-11AFLURIA
    63851-0613-11Flucelvax
    66521-0117-11FLUVIRIN
    66521-0117-12Fluvirin
    00006-4093-01RECOMBIVAX HB
    00006-4094-01RECOMBIVAX HB
    00006-4095-01VAQTA
    00006-4096-01VAQTA
    00006-4963-01ZOSTAVAX
    00006-4963-01ZOSTAVAX
    42874-0014-01Flublok
    49281-0414-88Fluzone Quadrivalent PF
    49281-0395-88Fluzone HD
    49281-0709-48FLUZONE Intradermal
    58160-0881-41FLUARIX
    58160-0809-01MENHIBRIX
    62577-0613-11Flucelvax
    19515-0893-02FLULAVAL
    49281-0621-78FLUZONE QUADRIVALENT
    00005-0100-01Trumenba
    00005-0100-01Trumenba
    00005-0100-01Trumenba
    00006-4047-01RotaTeq
    00006-4109-01GARDASIL
    62577-0613-11Flucelvax
    00006-4121-01GARDASIL 9
    00006-4119-01GARDASIL 9
    00006-4119-01GARDASIL 9
    63851-0511-11RabAvert
    49281-0562-58QUADRACEL
    46028-0114-11Bexsero
    46028-0114-11Bexsero
    00006-4171-01ProQuad
    13533-0131-00Tetanus and Diphtheria Toxoids Adsorbed
    49281-0396-78FLUZONE
    49281-0397-88FLUZONE High-Dose
    62577-0614-11Flucelvax
    58160-0903-41FLUARIX QUADRIVALENT
    19515-0898-01Flulaval Quadrivalent
    19515-0901-41Flulaval Quadrivalent
    49281-0393-88FLUZONE High-Dose
    58160-0810-43INFANRIX
    58160-0810-01INFANRIX
    49281-0790-38Typhim Vi
    49281-0790-88Typhim Vi
    49281-0640-15INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0650-10INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0650-90INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0650-25INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0650-70INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0650-50INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE
    49281-0707-48FLUZONE
    66019-0110-01FluMist
    00006-4681-01M-M-R II
    49281-0215-58TENIVAC
    49281-0215-88TENIVAC
    46028-0218-11Meningococcal (Groups A) CRM197 Oligosaccharide Co
    49281-0387-65FLUZONE
    49281-0386-15FLUZONE
    49281-0010-10FLUZONE
    49281-0010-25Fluzone
    49281-0010-50FLUZONE
    54868-0980-00M-M-R II
    58160-0830-43CERVARIX
    58160-0830-05CERVARIX
    00005-1971-01PREVNAR 13
    00005-1971-01PREVNAR 13
    00005-1971-01PREVNAR 13
    17478-0131-00Tetanus and Diphtheria Toxoids Adsorbed
    58160-0812-43KINRIX
    58160-0812-01KINRIX
    66019-0108-01FluMist
    00006-4898-01COMVAX
    58160-0809-01MENHIBRIX
    63851-0612-11Flucelvax
    00006-4992-01RECOMBIVAX HB
    00006-4981-01RECOMBIVAX HB
    00006-4980-00RECOMBIVAX HB
    00006-4093-01RECOMBIVAX HB
    00006-4094-01RECOMBIVAX HB
    00006-4109-01GARDASIL
    66521-0112-02FLUVIRIN
    66521-0112-10FLUVIRIN
    66019-0107-01FluMist
    49281-0225-58DIPHTHERIA AND TETANUS TOXOIDS ADSORBED
    49281-0705-55FLUZONE
    42515-0001-00IXIARO
    58160-0879-41FLUARIX
    58160-0880-41FLUARIX
    58160-0820-01ENGERIX-B
    58160-0820-43ENGERIX-B
    58160-0821-01ENGERIX-B
    58160-0821-43ENGERIX-B
    58160-0821-05ENGERIX-B
    42874-0012-01Flublok
    49281-0278-10DIPHTHERIA AND TETANUS TOXOIDS ADSORBED
    66019-0109-01FluMist
    19515-0890-02FLULAVAL
    19515-0889-02FLULAVAL
    58160-0900-41FLUARIX QUADRIVALENT
    49281-0860-78IPOL
    49281-0860-88IPOL
    49281-0389-65FLUZONE High-Dose
    49281-0388-15FLUZONE
    49281-0011-10FLUZONE
    49281-0011-50FLUZONE
    49281-0703-55FLUZONE Intradermal
    49281-0111-25FLUZONE
    66521-0200-10Influenza A (H1N1) 2009 Monovalent Vaccine
    66521-0200-02Influenza A (H1N1) 2009 Monovalent Vaccine
    49281-0298-10TRIPEDIA
    58160-0806-01HIBERIX
    33332-0013-02AFLURIA
    33332-0113-11AFLURIA
    49281-0391-65FLUZONE High-Dose
    49281-0012-50FLUZONE
    49281-0012-10FLUZONE
    49281-0112-25FLUZONE
    49281-0390-15FLUZONE
    00006-4897-01PedvaxHIB
    49281-0291-83DECAVAC
    49281-0291-10DECAVAC
    49281-0413-88FLUZONE QUADRIVALENT
    49281-0413-58FLUZONE QUADRIVALENT
    49281-0513-00FLUZONE QUADRIVALENT
    66521-0113-02Fluvirin
    66521-0113-10Fluvirin
    00005-1970-49Prevnar
    00006-4047-01RotaTeq
    58160-0811-43PEDIARIX
    58160-0811-41PEDIARIX
    00006-4827-01VARIVAX
    00006-4826-01VARIVAX
    58160-0842-41BOOSTRIX
    58160-0842-01BOOSTRIX
    58160-0842-43BOOSTRIX
    58160-0842-05BOOSTRIX
    66019-0300-01FluMist Quadrivalent
    49281-0589-58Menactra
    00006-4095-01VAQTA
    00006-4096-01VAQTA
    00006-4831-01VAQTA
    63851-0511-11RabAvert
    66019-0200-01Influenza A H1N1 2009 Monovalent Vaccine Live Intr
    14362-0111-03Tetanus and Diphtheria Toxoids Adsorbed
    33332-0519-01Influenza A
    33332-0519-25Influenza A
    33332-0629-10Influenza A
    58160-0825-43HAVRIX
    58160-0825-01HAVRIX
    58160-0826-43HAVRIX
    58160-0826-05HAVRIX
    58160-0826-01HAVRIX
    33332-0010-01AFLURIA
    33332-0110-10AFLURIA
    66521-0115-10Fluvirin
    66521-0115-02Fluvirin
    00006-4133-01Tetanus and Diphtheria Toxoids Adsorbed
    54868-4320-09PNEUMOVAX 23
    54868-3339-09PNEUMOVAX 23
    00052-0603-01BCG VACCINE
    64678-0211-05BioThrax
    00006-4739-01PNEUMOVAX 23
    00006-4943-01PNEUMOVAX 23
    49281-0013-58FLUZONE
    49281-0013-88FLUZONE
    49281-0392-78FLUZONE
    49281-0113-00FLUZONE
    49281-0820-10TETANUS TOXOID ADSORBED
    49281-0800-83TETANUS TOXOID ADSORBED
    49281-0400-88Adacel
    49281-0286-58DAPTACEL
    49281-0286-58DAPTACEL
    49281-0286-58DAPTACEL
    58160-0815-41TWINRIX
    58160-0815-43TWINRIX
    58160-0815-05TWINRIX
    58160-0815-43TWINRIX
    58160-0815-01TWINRIX
    66521-0114-10Fluvirin
    76420-0482-01FLUVIRIN
    19515-0895-01Flulaval Quadrivalent
    00006-4999-01ProQuad
    49281-0545-15ACTHIB
    51285-0174-02Adenovirus Type 4 Vaccine, Live, Oral
    49281-0248-58IMOVAX RABIES
    49281-0487-58MENOMUNE - A/C/Y/W-135 COMBINED
    49281-0915-58YF-VAX
    49281-0547-58ACTHIB
    58160-0851-01ROTARIX
    49281-0915-68YF-VAX
    49281-0488-78MENOMUNE - A/C/Y/W-135 COMBINED
    46028-0219-11Meningococcal (Groups C, Y, W-135) CRM197 Oligosac
    51285-0175-02Adenovirus Type 7 Vaccine, Live, Oral
    49281-0560-05DTAP-IPV
    49281-0400-58Adacel
    49281-0400-58Adacel
    42874-0013-01Flublok
    66521-0116-11FLUVIRIN
    66521-0116-12FLUVIRIN
    00006-4045-01GARDASIL
    00006-4045-01GARDASIL
    00006-4995-01RECOMBIVAX HB
    00006-4995-01RECOMBIVAX HB
    00006-4841-01VAQTA
    00006-4841-01VAQTA
    58160-0804-01INFLUENZA (H5N1), adjuvanted
    58160-0802-02AS03 Adjuvant
    58160-0901-41FLUARIX QUADRIVALENT
    00006-4837-01PNEUMOVAX 23
    19515-0891-01Flulaval Quadrivalent
    19515-0893-02FLULAVAL
    19515-0894-41Flulaval Quadrivalent
    49281-0514-00Fluzone Quadrivalent, Peds
    49281-0394-78FLUZONE
    49281-0014-88FLUZONE
    49281-0414-58FLUZONE QUADRIVALENT PF

{
  "resourceType" : "ValueSet",
  "id" : "us-core-ndc-vaccine-codes",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.109Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Vaccine National Drug Code (NDC)</h2><div><p>This value set includes all the Vaccine National Drug Codes (NDC). This source of this data is provided by the [CDC] (https://www2a.cdc.gov/vaccines/iis/iisstandards/ndc_crosswalk.asp)</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <code>http://hl7.org/fhir/sid/ndc</code><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td>49281-0589-58</td><td>Menactra</td><td/></tr><tr><td>49281-0623-78</td><td>FLUZONE QUADRIVALENT</td><td/></tr><tr><td>49281-0515-00</td><td>Fluzone Quadrivalent, peds</td><td/></tr><tr><td>49281-0415-88</td><td>Fluzone Quadrivalent PF</td><td/></tr><tr><td>49281-0415-58</td><td>FLUZONE QUADRIVALENT PF</td><td/></tr><tr><td>33332-0115-11</td><td>AFLURIA</td><td/></tr><tr><td>33332-0015-02</td><td>AFLURIA</td><td/></tr><tr><td>66019-0302-01</td><td>FluMist Quadrivalent</td><td/></tr><tr><td>42874-0015-01</td><td>Flublok</td><td/></tr><tr><td>66521-0118-12</td><td>Fluvirin</td><td/></tr><tr><td>66521-0118-11</td><td>Fluvirin</td><td/></tr><tr><td>58160-0883-41</td><td>FLUARIX</td><td/></tr><tr><td>66521-0000-11</td><td>Fluad</td><td/></tr><tr><td>69401-0000-01</td><td>Vivotif</td><td/></tr><tr><td>66019-0301-01</td><td>FluMist Quadrivalent</td><td/></tr><tr><td>33332-0014-02</td><td>AFLURIA</td><td/></tr><tr><td>33332-0114-11</td><td>AFLURIA</td><td/></tr><tr><td>63851-0613-11</td><td>Flucelvax</td><td/></tr><tr><td>66521-0117-11</td><td>FLUVIRIN</td><td/></tr><tr><td>66521-0117-12</td><td>Fluvirin</td><td/></tr><tr><td>00006-4093-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4094-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4095-01</td><td>VAQTA</td><td/></tr><tr><td>00006-4096-01</td><td>VAQTA</td><td/></tr><tr><td>00006-4963-01</td><td>ZOSTAVAX</td><td/></tr><tr><td>00006-4963-01</td><td>ZOSTAVAX</td><td/></tr><tr><td>42874-0014-01</td><td>Flublok</td><td/></tr><tr><td>49281-0414-88</td><td>Fluzone Quadrivalent PF</td><td/></tr><tr><td>49281-0395-88</td><td>Fluzone HD</td><td/></tr><tr><td>49281-0709-48</td><td>FLUZONE Intradermal</td><td/></tr><tr><td>58160-0881-41</td><td>FLUARIX</td><td/></tr><tr><td>58160-0809-01</td><td>MENHIBRIX</td><td/></tr><tr><td>62577-0613-11</td><td>Flucelvax</td><td/></tr><tr><td>19515-0893-02</td><td>FLULAVAL</td><td/></tr><tr><td>49281-0621-78</td><td>FLUZONE QUADRIVALENT</td><td/></tr><tr><td>00005-0100-01</td><td>Trumenba</td><td/></tr><tr><td>00005-0100-01</td><td>Trumenba</td><td/></tr><tr><td>00005-0100-01</td><td>Trumenba</td><td/></tr><tr><td>00006-4047-01</td><td>RotaTeq</td><td/></tr><tr><td>00006-4109-01</td><td>GARDASIL</td><td/></tr><tr><td>62577-0613-11</td><td>Flucelvax</td><td/></tr><tr><td>00006-4121-01</td><td>GARDASIL 9</td><td/></tr><tr><td>00006-4119-01</td><td>GARDASIL 9</td><td/></tr><tr><td>00006-4119-01</td><td>GARDASIL 9</td><td/></tr><tr><td>63851-0511-11</td><td>RabAvert</td><td/></tr><tr><td>49281-0562-58</td><td>QUADRACEL</td><td/></tr><tr><td>46028-0114-11</td><td>Bexsero</td><td/></tr><tr><td>46028-0114-11</td><td>Bexsero</td><td/></tr><tr><td>00006-4171-01</td><td>ProQuad</td><td/></tr><tr><td>13533-0131-00</td><td>Tetanus and Diphtheria Toxoids Adsorbed</td><td/></tr><tr><td>49281-0396-78</td><td>FLUZONE</td><td/></tr><tr><td>49281-0397-88</td><td>FLUZONE High-Dose</td><td/></tr><tr><td>62577-0614-11</td><td>Flucelvax</td><td/></tr><tr><td>58160-0903-41</td><td>FLUARIX QUADRIVALENT</td><td/></tr><tr><td>19515-0898-01</td><td>Flulaval Quadrivalent</td><td/></tr><tr><td>19515-0901-41</td><td>Flulaval Quadrivalent</td><td/></tr><tr><td>49281-0393-88</td><td>FLUZONE High-Dose</td><td/></tr><tr><td>58160-0810-43</td><td>INFANRIX</td><td/></tr><tr><td>58160-0810-01</td><td>INFANRIX</td><td/></tr><tr><td>49281-0790-38</td><td>Typhim Vi</td><td/></tr><tr><td>49281-0790-88</td><td>Typhim Vi</td><td/></tr><tr><td>49281-0640-15</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0650-10</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0650-90</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0650-25</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0650-70</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0650-50</td><td>INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE</td><td/></tr><tr><td>49281-0707-48</td><td>FLUZONE</td><td/></tr><tr><td>66019-0110-01</td><td>FluMist</td><td/></tr><tr><td>00006-4681-01</td><td>M-M-R II</td><td/></tr><tr><td>49281-0215-58</td><td>TENIVAC</td><td/></tr><tr><td>49281-0215-88</td><td>TENIVAC</td><td/></tr><tr><td>46028-0218-11</td><td>Meningococcal (Groups A) CRM197 Oligosaccharide Co</td><td/></tr><tr><td>49281-0387-65</td><td>FLUZONE</td><td/></tr><tr><td>49281-0386-15</td><td>FLUZONE</td><td/></tr><tr><td>49281-0010-10</td><td>FLUZONE</td><td/></tr><tr><td>49281-0010-25</td><td>Fluzone</td><td/></tr><tr><td>49281-0010-50</td><td>FLUZONE</td><td/></tr><tr><td>54868-0980-00</td><td>M-M-R II</td><td/></tr><tr><td>58160-0830-43</td><td>CERVARIX</td><td/></tr><tr><td>58160-0830-05</td><td>CERVARIX</td><td/></tr><tr><td>00005-1971-01</td><td>PREVNAR 13</td><td/></tr><tr><td>00005-1971-01</td><td>PREVNAR 13</td><td/></tr><tr><td>00005-1971-01</td><td>PREVNAR 13</td><td/></tr><tr><td>17478-0131-00</td><td>Tetanus and Diphtheria Toxoids Adsorbed</td><td/></tr><tr><td>58160-0812-43</td><td>KINRIX</td><td/></tr><tr><td>58160-0812-01</td><td>KINRIX</td><td/></tr><tr><td>66019-0108-01</td><td>FluMist</td><td/></tr><tr><td>00006-4898-01</td><td>COMVAX</td><td/></tr><tr><td>58160-0809-01</td><td>MENHIBRIX</td><td/></tr><tr><td>63851-0612-11</td><td>Flucelvax</td><td/></tr><tr><td>00006-4992-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4981-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4980-00</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4093-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4094-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4109-01</td><td>GARDASIL</td><td/></tr><tr><td>66521-0112-02</td><td>FLUVIRIN</td><td/></tr><tr><td>66521-0112-10</td><td>FLUVIRIN</td><td/></tr><tr><td>66019-0107-01</td><td>FluMist</td><td/></tr><tr><td>49281-0225-58</td><td>DIPHTHERIA AND TETANUS TOXOIDS ADSORBED</td><td/></tr><tr><td>49281-0705-55</td><td>FLUZONE</td><td/></tr><tr><td>42515-0001-00</td><td>IXIARO</td><td/></tr><tr><td>58160-0879-41</td><td>FLUARIX</td><td/></tr><tr><td>58160-0880-41</td><td>FLUARIX</td><td/></tr><tr><td>58160-0820-01</td><td>ENGERIX-B</td><td/></tr><tr><td>58160-0820-43</td><td>ENGERIX-B</td><td/></tr><tr><td>58160-0821-01</td><td>ENGERIX-B</td><td/></tr><tr><td>58160-0821-43</td><td>ENGERIX-B</td><td/></tr><tr><td>58160-0821-05</td><td>ENGERIX-B</td><td/></tr><tr><td>42874-0012-01</td><td>Flublok</td><td/></tr><tr><td>49281-0278-10</td><td>DIPHTHERIA AND TETANUS TOXOIDS ADSORBED</td><td/></tr><tr><td>66019-0109-01</td><td>FluMist</td><td/></tr><tr><td>19515-0890-02</td><td>FLULAVAL</td><td/></tr><tr><td>19515-0889-02</td><td>FLULAVAL</td><td/></tr><tr><td>58160-0900-41</td><td>FLUARIX QUADRIVALENT</td><td/></tr><tr><td>49281-0860-78</td><td>IPOL</td><td/></tr><tr><td>49281-0860-88</td><td>IPOL</td><td/></tr><tr><td>49281-0389-65</td><td>FLUZONE High-Dose</td><td/></tr><tr><td>49281-0388-15</td><td>FLUZONE</td><td/></tr><tr><td>49281-0011-10</td><td>FLUZONE</td><td/></tr><tr><td>49281-0011-50</td><td>FLUZONE</td><td/></tr><tr><td>49281-0703-55</td><td>FLUZONE Intradermal</td><td/></tr><tr><td>49281-0111-25</td><td>FLUZONE</td><td/></tr><tr><td>66521-0200-10</td><td>Influenza A (H1N1) 2009 Monovalent Vaccine</td><td/></tr><tr><td>66521-0200-02</td><td>Influenza A (H1N1) 2009 Monovalent Vaccine</td><td/></tr><tr><td>49281-0298-10</td><td>TRIPEDIA</td><td/></tr><tr><td>58160-0806-01</td><td>HIBERIX</td><td/></tr><tr><td>33332-0013-02</td><td>AFLURIA</td><td/></tr><tr><td>33332-0113-11</td><td>AFLURIA</td><td/></tr><tr><td>49281-0391-65</td><td>FLUZONE High-Dose</td><td/></tr><tr><td>49281-0012-50</td><td>FLUZONE</td><td/></tr><tr><td>49281-0012-10</td><td>FLUZONE</td><td/></tr><tr><td>49281-0112-25</td><td>FLUZONE</td><td/></tr><tr><td>49281-0390-15</td><td>FLUZONE</td><td/></tr><tr><td>00006-4897-01</td><td>PedvaxHIB</td><td/></tr><tr><td>49281-0291-83</td><td>DECAVAC</td><td/></tr><tr><td>49281-0291-10</td><td>DECAVAC</td><td/></tr><tr><td>49281-0413-88</td><td>FLUZONE QUADRIVALENT</td><td/></tr><tr><td>49281-0413-58</td><td>FLUZONE QUADRIVALENT</td><td/></tr><tr><td>49281-0513-00</td><td>FLUZONE QUADRIVALENT</td><td/></tr><tr><td>66521-0113-02</td><td>Fluvirin</td><td/></tr><tr><td>66521-0113-10</td><td>Fluvirin</td><td/></tr><tr><td>00005-1970-49</td><td>Prevnar</td><td/></tr><tr><td>00006-4047-01</td><td>RotaTeq</td><td/></tr><tr><td>58160-0811-43</td><td>PEDIARIX</td><td/></tr><tr><td>58160-0811-41</td><td>PEDIARIX</td><td/></tr><tr><td>00006-4827-01</td><td>VARIVAX</td><td/></tr><tr><td>00006-4826-01</td><td>VARIVAX</td><td/></tr><tr><td>58160-0842-41</td><td>BOOSTRIX</td><td/></tr><tr><td>58160-0842-01</td><td>BOOSTRIX</td><td/></tr><tr><td>58160-0842-43</td><td>BOOSTRIX</td><td/></tr><tr><td>58160-0842-05</td><td>BOOSTRIX</td><td/></tr><tr><td>66019-0300-01</td><td>FluMist Quadrivalent</td><td/></tr><tr><td>49281-0589-58</td><td>Menactra</td><td/></tr><tr><td>00006-4095-01</td><td>VAQTA</td><td/></tr><tr><td>00006-4096-01</td><td>VAQTA</td><td/></tr><tr><td>00006-4831-01</td><td>VAQTA</td><td/></tr><tr><td>63851-0511-11</td><td>RabAvert</td><td/></tr><tr><td>66019-0200-01</td><td>Influenza A H1N1 2009 Monovalent Vaccine Live Intr</td><td/></tr><tr><td>14362-0111-03</td><td>Tetanus and Diphtheria Toxoids Adsorbed</td><td/></tr><tr><td>33332-0519-01</td><td>Influenza A</td><td/></tr><tr><td>33332-0519-25</td><td>Influenza A</td><td/></tr><tr><td>33332-0629-10</td><td>Influenza A</td><td/></tr><tr><td>58160-0825-43</td><td>HAVRIX</td><td/></tr><tr><td>58160-0825-01</td><td>HAVRIX</td><td/></tr><tr><td>58160-0826-43</td><td>HAVRIX</td><td/></tr><tr><td>58160-0826-05</td><td>HAVRIX</td><td/></tr><tr><td>58160-0826-01</td><td>HAVRIX</td><td/></tr><tr><td>33332-0010-01</td><td>AFLURIA</td><td/></tr><tr><td>33332-0110-10</td><td>AFLURIA</td><td/></tr><tr><td>66521-0115-10</td><td>Fluvirin</td><td/></tr><tr><td>66521-0115-02</td><td>Fluvirin</td><td/></tr><tr><td>00006-4133-01</td><td>Tetanus and Diphtheria Toxoids Adsorbed</td><td/></tr><tr><td>54868-4320-09</td><td>PNEUMOVAX 23</td><td/></tr><tr><td>54868-3339-09</td><td>PNEUMOVAX 23</td><td/></tr><tr><td>00052-0603-01</td><td>BCG VACCINE</td><td/></tr><tr><td>64678-0211-05</td><td>BioThrax</td><td/></tr><tr><td>00006-4739-01</td><td>PNEUMOVAX 23</td><td/></tr><tr><td>00006-4943-01</td><td>PNEUMOVAX 23</td><td/></tr><tr><td>49281-0013-58</td><td>FLUZONE</td><td/></tr><tr><td>49281-0013-88</td><td>FLUZONE</td><td/></tr><tr><td>49281-0392-78</td><td>FLUZONE</td><td/></tr><tr><td>49281-0113-00</td><td>FLUZONE</td><td/></tr><tr><td>49281-0820-10</td><td>TETANUS TOXOID ADSORBED</td><td/></tr><tr><td>49281-0800-83</td><td>TETANUS TOXOID ADSORBED</td><td/></tr><tr><td>49281-0400-88</td><td>Adacel</td><td/></tr><tr><td>49281-0286-58</td><td>DAPTACEL</td><td/></tr><tr><td>49281-0286-58</td><td>DAPTACEL</td><td/></tr><tr><td>49281-0286-58</td><td>DAPTACEL</td><td/></tr><tr><td>58160-0815-41</td><td>TWINRIX</td><td/></tr><tr><td>58160-0815-43</td><td>TWINRIX</td><td/></tr><tr><td>58160-0815-05</td><td>TWINRIX</td><td/></tr><tr><td>58160-0815-43</td><td>TWINRIX</td><td/></tr><tr><td>58160-0815-01</td><td>TWINRIX</td><td/></tr><tr><td>66521-0114-10</td><td>Fluvirin</td><td/></tr><tr><td>76420-0482-01</td><td>FLUVIRIN</td><td/></tr><tr><td>19515-0895-01</td><td>Flulaval Quadrivalent</td><td/></tr><tr><td>00006-4999-01</td><td>ProQuad</td><td/></tr><tr><td>49281-0545-15</td><td>ACTHIB</td><td/></tr><tr><td>51285-0174-02</td><td>Adenovirus Type 4 Vaccine, Live, Oral</td><td/></tr><tr><td>49281-0248-58</td><td>IMOVAX RABIES</td><td/></tr><tr><td>49281-0487-58</td><td>MENOMUNE - A/C/Y/W-135 COMBINED</td><td/></tr><tr><td>49281-0915-58</td><td>YF-VAX</td><td/></tr><tr><td>49281-0547-58</td><td>ACTHIB</td><td/></tr><tr><td>58160-0851-01</td><td>ROTARIX</td><td/></tr><tr><td>49281-0915-68</td><td>YF-VAX</td><td/></tr><tr><td>49281-0488-78</td><td>MENOMUNE - A/C/Y/W-135 COMBINED</td><td/></tr><tr><td>46028-0219-11</td><td>Meningococcal (Groups C, Y, W-135) CRM197 Oligosac</td><td/></tr><tr><td>51285-0175-02</td><td>Adenovirus Type 7 Vaccine, Live, Oral</td><td/></tr><tr><td>49281-0560-05</td><td>DTAP-IPV</td><td/></tr><tr><td>49281-0400-58</td><td>Adacel</td><td/></tr><tr><td>49281-0400-58</td><td>Adacel</td><td/></tr><tr><td>42874-0013-01</td><td>Flublok</td><td/></tr><tr><td>66521-0116-11</td><td>FLUVIRIN</td><td/></tr><tr><td>66521-0116-12</td><td>FLUVIRIN</td><td/></tr><tr><td>00006-4045-01</td><td>GARDASIL</td><td/></tr><tr><td>00006-4045-01</td><td>GARDASIL</td><td/></tr><tr><td>00006-4995-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4995-01</td><td>RECOMBIVAX HB</td><td/></tr><tr><td>00006-4841-01</td><td>VAQTA</td><td/></tr><tr><td>00006-4841-01</td><td>VAQTA</td><td/></tr><tr><td>58160-0804-01</td><td>INFLUENZA (H5N1), adjuvanted</td><td/></tr><tr><td>58160-0802-02</td><td>AS03 Adjuvant</td><td/></tr><tr><td>58160-0901-41</td><td>FLUARIX QUADRIVALENT</td><td/></tr><tr><td>00006-4837-01</td><td>PNEUMOVAX 23</td><td/></tr><tr><td>19515-0891-01</td><td>Flulaval Quadrivalent</td><td/></tr><tr><td>19515-0893-02</td><td>FLULAVAL</td><td/></tr><tr><td>19515-0894-41</td><td>Flulaval Quadrivalent</td><td/></tr><tr><td>49281-0514-00</td><td>Fluzone Quadrivalent, Peds</td><td/></tr><tr><td>49281-0394-78</td><td>FLUZONE</td><td/></tr><tr><td>49281-0014-88</td><td>FLUZONE</td><td/></tr><tr><td>49281-0414-58</td><td>FLUZONE QUADRIVALENT PF</td><td/></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-ndc-vaccine-codes",
  "version" : "2.0.0",
  "name" : "Vaccine National Drug Code (NDC)",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "description" : "This value set includes all the Vaccine National Drug Codes (NDC). This source of this data is provided by the [CDC] (https://www2a.cdc.gov/vaccines/iis/iisstandards/ndc_crosswalk.asp)",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "purpose" : "Codes that are used as translations for CVS code for implementation of the Argonaut Immunization IG and MU2015 certification.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/sid/ndc",
        "concept" : [
          {
            "code" : "49281-0589-58",
            "display" : "Menactra",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS GROUP A CAPSULAR POLYSACCHARIDE DIPHTHERIA TOXOID CONJUGATE ANTIGEN, NEISSERI"
              }
            ]
          },
          {
            "code" : "49281-0623-78",
            "display" : "FLUZONE QUADRIVALENT"
          },
          {
            "code" : "49281-0515-00",
            "display" : "Fluzone Quadrivalent, peds"
          },
          {
            "code" : "49281-0415-88",
            "display" : "Fluzone Quadrivalent PF"
          },
          {
            "code" : "49281-0415-58",
            "display" : "FLUZONE QUADRIVALENT PF"
          },
          {
            "code" : "33332-0115-11",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS"
              }
            ]
          },
          {
            "code" : "33332-0015-02",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS"
              }
            ]
          },
          {
            "code" : "66019-0302-01",
            "display" : "FluMist Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "42874-0015-01",
            "display" : "Flublok",
            "designation" : [
              {
                "value" : "influenza virus vaccine"
              }
            ]
          },
          {
            "code" : "66521-0118-12",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS"
              }
            ]
          },
          {
            "code" : "66521-0118-11",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "Influenza Virus Vaccine"
              }
            ]
          },
          {
            "code" : "58160-0883-41",
            "display" : "FLUARIX",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "66521-0000-11",
            "display" : "Fluad",
            "designation" : [
              {
                "value" : "TRIVALENT INFLUENZA WITH ADJUVANT 2015/2016"
              }
            ]
          },
          {
            "code" : "69401-0000-01",
            "display" : "Vivotif",
            "designation" : [
              {
                "value" : "SALMONELLA TYPHI TY21A"
              }
            ]
          },
          {
            "code" : "66019-0301-01",
            "display" : "FluMist Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "33332-0014-02",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "33332-0114-11",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "63851-0613-11",
            "display" : "Flucelvax"
          },
          {
            "code" : "66521-0117-11",
            "display" : "FLUVIRIN"
          },
          {
            "code" : "66521-0117-12",
            "display" : "Fluvirin"
          },
          {
            "code" : "00006-4093-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4094-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4095-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "00006-4096-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "00006-4963-01",
            "display" : "ZOSTAVAX",
            "designation" : [
              {
                "value" : "ZOSTER VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "00006-4963-01",
            "display" : "ZOSTAVAX",
            "designation" : [
              {
                "value" : "ZOSTER VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "42874-0014-01",
            "display" : "Flublok",
            "designation" : [
              {
                "value" : "influenza virus vaccine"
              }
            ]
          },
          {
            "code" : "49281-0414-88",
            "display" : "Fluzone Quadrivalent PF"
          },
          {
            "code" : "49281-0395-88",
            "display" : "Fluzone HD"
          },
          {
            "code" : "49281-0709-48",
            "display" : "FLUZONE Intradermal"
          },
          {
            "code" : "58160-0881-41",
            "display" : "FLUARIX",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0809-01",
            "display" : "MENHIBRIX",
            "designation" : [
              {
                "value" : "MENINGOCOCCAL GROUPS C AND Y AND HAEMOPHILUS B TETANUS TOXOID CONJUGATE VACCINE"
              }
            ]
          },
          {
            "code" : "62577-0613-11",
            "display" : "Flucelvax",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/BRISBANE/10/2010 (H1N1) ANTIGEN (MDCK CELL DERIVED, PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "19515-0893-02",
            "display" : "FLULAVAL",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0621-78",
            "display" : "FLUZONE QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "00005-0100-01",
            "display" : "Trumenba",
            "designation" : [
              {
                "value" : "Meningococcal B, recombinant"
              }
            ]
          },
          {
            "code" : "00005-0100-01",
            "display" : "Trumenba",
            "designation" : [
              {
                "value" : "Meningococcal B, recombinant"
              }
            ]
          },
          {
            "code" : "00005-0100-01",
            "display" : "Trumenba",
            "designation" : [
              {
                "value" : "Meningococcal B, recombinant"
              }
            ]
          },
          {
            "code" : "00006-4047-01",
            "display" : "RotaTeq",
            "designation" : [
              {
                "value" : "ROTAVIRUS VACCINE, LIVE, ORAL, PENTAVALENT"
              }
            ]
          },
          {
            "code" : "00006-4109-01",
            "display" : "GARDASIL",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS QUADRIVALENT (TYPES 6, 11, 16, AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "62577-0613-11",
            "display" : "Flucelvax",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/BRISBANE/10/2010 (H1N1) ANTIGEN (MDCK CELL DERIVED, PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "00006-4121-01",
            "display" : "GARDASIL 9",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS 9-VALENT VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "00006-4119-01",
            "display" : "GARDASIL 9",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS 9-VALENT VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "00006-4119-01",
            "display" : "GARDASIL 9",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS 9-VALENT VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "63851-0511-11",
            "display" : "RabAvert",
            "designation" : [
              {
                "value" : "RABIES VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0562-58",
            "display" : "QUADRACEL",
            "designation" : [
              {
                "value" : "DTAP, IPV"
              }
            ]
          },
          {
            "code" : "46028-0114-11",
            "display" : "Bexsero",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS SEROGROUP B NHBA FUSION PROTEIN ANTIGEN, NEISSERIA MENINGITIDIS SEROGROUP B F"
              }
            ]
          },
          {
            "code" : "46028-0114-11",
            "display" : "Bexsero",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS SEROGROUP B NHBA FUSION PROTEIN ANTIGEN, NEISSERIA MENINGITIDIS SEROGROUP B F"
              }
            ]
          },
          {
            "code" : "00006-4171-01",
            "display" : "ProQuad",
            "designation" : [
              {
                "value" : "MEASLES, MUMPS, RUBELLA AND VARICELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "13533-0131-00",
            "display" : "Tetanus and Diphtheria Toxoids Adsorbed",
            "designation" : [
              {
                "value" : "TETANUS AND DIPHTHERIA TOXOIDS ADSORBED"
              }
            ]
          },
          {
            "code" : "49281-0396-78",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0397-88",
            "display" : "FLUZONE High-Dose",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "62577-0614-11",
            "display" : "Flucelvax",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/BRISBANE/10/2010 (H1N1) ANTIGEN (MDCK CELL DERIVED, PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "58160-0903-41",
            "display" : "FLUARIX QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "19515-0898-01",
            "display" : "Flulaval Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "19515-0901-41",
            "display" : "Flulaval Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0393-88",
            "display" : "FLUZONE High-Dose",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "58160-0810-43",
            "display" : "INFANRIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS VACCINE ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0810-01",
            "display" : "INFANRIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS VACCINE ADSORBED"
              }
            ]
          },
          {
            "code" : "49281-0790-38",
            "display" : "Typhim Vi",
            "designation" : [
              {
                "value" : "SALMONELLA TYPHI TY2 VI POLYSACCHARIDE ANTIGEN"
              }
            ]
          },
          {
            "code" : "49281-0790-88",
            "display" : "Typhim Vi",
            "designation" : [
              {
                "value" : "SALMONELLA TYPHI TY2 VI POLYSACCHARIDE ANTIGEN"
              }
            ]
          },
          {
            "code" : "49281-0640-15",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0650-10",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0650-90",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0650-25",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0650-70",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0650-50",
            "display" : "INFLUENZA A (H1N1) 2009 MONOVALENT VACCINE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0707-48",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "66019-0110-01",
            "display" : "FluMist",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "00006-4681-01",
            "display" : "M-M-R II",
            "designation" : [
              {
                "value" : "MEASLES, MUMPS, AND RUBELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "49281-0215-58",
            "display" : "TENIVAC",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CORYNEBACTERIUM DIPHTHERIAE TOXOID"
              }
            ]
          },
          {
            "code" : "49281-0215-88",
            "display" : "TENIVAC",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CORYNEBACTERIUM DIPHTHERIAE TOXOID"
              }
            ]
          },
          {
            "code" : "46028-0218-11",
            "display" : "Meningococcal (Groups A) CRM197 Oligosaccharide Co",
            "designation" : [
              {
                "value" : "MENA VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0387-65",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0386-15",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0010-10",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0010-25",
            "display" : "Fluzone",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "49281-0010-50",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "54868-0980-00",
            "display" : "M-M-R II",
            "designation" : [
              {
                "value" : "MEASLES, MUMPS, AND RUBELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "58160-0830-43",
            "display" : "CERVARIX",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS BIVALENT (TYPES 16 AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "58160-0830-05",
            "display" : "CERVARIX",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS BIVALENT (TYPES 16 AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "00005-1971-01",
            "display" : "PREVNAR 13",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL 13-VALENT CONJUGATE VACCINE"
              }
            ]
          },
          {
            "code" : "00005-1971-01",
            "display" : "PREVNAR 13",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL 13-VALENT CONJUGATE VACCINE"
              }
            ]
          },
          {
            "code" : "00005-1971-01",
            "display" : "PREVNAR 13",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL 13-VALENT CONJUGATE VACCINE"
              }
            ]
          },
          {
            "code" : "17478-0131-00",
            "display" : "Tetanus and Diphtheria Toxoids Adsorbed",
            "designation" : [
              {
                "value" : "TETANUS AND DIPHTHERIA TOXOIDS ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0812-43",
            "display" : "KINRIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS ADSORBED AND INACTIVATED POLIOVIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0812-01",
            "display" : "KINRIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS ADSORBED AND INACTIVATED POLIOVIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "66019-0108-01",
            "display" : "FluMist",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "00006-4898-01",
            "display" : "COMVAX",
            "designation" : [
              {
                "value" : "HAEMOPHILUS B CONJUGATE (MENINGOCOCCAL PROTEIN CONJUGATE) AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0809-01",
            "display" : "MENHIBRIX",
            "designation" : [
              {
                "value" : "MENINGOCOCCAL GROUPS C AND Y AND HAEMOPHILUS B TETANUS TOXOID CONJUGATE VACCINE"
              }
            ]
          },
          {
            "code" : "63851-0612-11",
            "display" : "Flucelvax",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/BRISBANE/10/2010 (H1N1) ANTIGEN (MDCK CELL DERIVED, PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "00006-4992-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4981-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4980-00",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4093-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4094-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4109-01",
            "display" : "GARDASIL",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS QUADRIVALENT (TYPES 6, 11, 16, AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "66521-0112-02",
            "display" : "FLUVIRIN",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "66521-0112-10",
            "display" : "FLUVIRIN",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "66019-0107-01",
            "display" : "FluMist",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "49281-0225-58",
            "display" : "DIPHTHERIA AND TETANUS TOXOIDS ADSORBED",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CLOSTRIDIUM TETANI TOXOID"
              }
            ]
          },
          {
            "code" : "49281-0705-55",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "42515-0001-00",
            "display" : "IXIARO",
            "designation" : [
              {
                "value" : "JAPANESE ENCEPHALITIS VACCINE, INACTIVATED, ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0879-41",
            "display" : "FLUARIX",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0880-41",
            "display" : "FLUARIX",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0820-01",
            "display" : "ENGERIX-B",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "58160-0820-43",
            "display" : "ENGERIX-B",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "58160-0821-01",
            "display" : "ENGERIX-B",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "58160-0821-43",
            "display" : "ENGERIX-B",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "58160-0821-05",
            "display" : "ENGERIX-B",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "42874-0012-01",
            "display" : "Flublok",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0278-10",
            "display" : "DIPHTHERIA AND TETANUS TOXOIDS ADSORBED",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CLOSTRIDIUM TETANI TOXOID"
              }
            ]
          },
          {
            "code" : "66019-0109-01",
            "display" : "FluMist",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "19515-0890-02",
            "display" : "FLULAVAL",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "19515-0889-02",
            "display" : "FLULAVAL",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0900-41",
            "display" : "FLUARIX QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0860-78",
            "display" : "IPOL",
            "designation" : [
              {
                "value" : "POLIOVIRUS TYPE 1 ANTIGEN (FORMALDEHYDE INACTIVATED), POLIOVIRUS TYPE 2 ANTIGEN (FORMALDEHYDE INACTI"
              }
            ]
          },
          {
            "code" : "49281-0860-88",
            "display" : "IPOL",
            "designation" : [
              {
                "value" : "POLIOVIRUS TYPE 1 ANTIGEN (FORMALDEHYDE INACTIVATED), POLIOVIRUS TYPE 2 ANTIGEN (FORMALDEHYDE INACTI"
              }
            ]
          },
          {
            "code" : "49281-0389-65",
            "display" : "FLUZONE High-Dose",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0388-15",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0011-10",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0011-50",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0703-55",
            "display" : "FLUZONE Intradermal",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0111-25",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "66521-0200-10",
            "display" : "Influenza A (H1N1) 2009 Monovalent Vaccine",
            "designation" : [
              {
                "value" : "Influenza A (H1N1) 2009 Monovalent Vaccine"
              }
            ]
          },
          {
            "code" : "66521-0200-02",
            "display" : "Influenza A (H1N1) 2009 Monovalent Vaccine",
            "designation" : [
              {
                "value" : "Influenza A (H1N1) 2009 Monovalent Vaccine"
              }
            ]
          },
          {
            "code" : "49281-0298-10",
            "display" : "TRIPEDIA",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CLOSTRIDIUM TETANI TOXOID ANT"
              }
            ]
          },
          {
            "code" : "58160-0806-01",
            "display" : "HIBERIX",
            "designation" : [
              {
                "value" : "HAEMOPHILUS B CONJUGATE VACCINE (TETANUS TOXOID CONJUGATE)"
              }
            ]
          },
          {
            "code" : "33332-0013-02",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "33332-0113-11",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0391-65",
            "display" : "FLUZONE High-Dose",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0012-50",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0012-10",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0112-25",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0390-15",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "00006-4897-01",
            "display" : "PedvaxHIB",
            "designation" : [
              {
                "value" : "HAEMOPHILUS B CONJUGATE VACCINE (MENINGOCOCCAL PROTEIN CONJUGATE)"
              }
            ]
          },
          {
            "code" : "49281-0291-83",
            "display" : "DECAVAC",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CORYNEBACTERIUM DIPHTHERIAE TOXOID"
              }
            ]
          },
          {
            "code" : "49281-0291-10",
            "display" : "DECAVAC",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED) AND CORYNEBACTERIUM DIPHTHERIAE TOXOID"
              }
            ]
          },
          {
            "code" : "49281-0413-88",
            "display" : "FLUZONE QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0413-58",
            "display" : "FLUZONE QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0513-00",
            "display" : "FLUZONE QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "66521-0113-02",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "Influenza Virus Vaccine"
              }
            ]
          },
          {
            "code" : "66521-0113-10",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CHRISTCHURCH/16/2010 NIB-74 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZ"
              }
            ]
          },
          {
            "code" : "00005-1970-49",
            "display" : "Prevnar",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL 7-VALENT"
              }
            ]
          },
          {
            "code" : "00006-4047-01",
            "display" : "RotaTeq",
            "designation" : [
              {
                "value" : "ROTAVIRUS VACCINE, LIVE, ORAL, PENTAVALENT"
              }
            ]
          },
          {
            "code" : "58160-0811-43",
            "display" : "PEDIARIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS ADSORBED, HEPATITIS B (RECOMBINANT) AND INACT"
              }
            ]
          },
          {
            "code" : "58160-0811-41",
            "display" : "PEDIARIX",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS ADSORBED, HEPATITIS B (RECOMBINANT) AND INACT"
              }
            ]
          },
          {
            "code" : "00006-4827-01",
            "display" : "VARIVAX",
            "designation" : [
              {
                "value" : "VARICELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "00006-4826-01",
            "display" : "VARIVAX",
            "designation" : [
              {
                "value" : "VARICELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "58160-0842-41",
            "display" : "BOOSTRIX",
            "designation" : [
              {
                "value" : "TETANUS TOXOID, REDUCED DIPHTHERIA TOXOID AND ACELLULAR PERTUSSIS VACCINE, ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0842-01",
            "display" : "BOOSTRIX",
            "designation" : [
              {
                "value" : "TETANUS TOXOID, REDUCED DIPHTHERIA TOXOID AND ACELLULAR PERTUSSIS VACCINE, ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0842-43",
            "display" : "BOOSTRIX",
            "designation" : [
              {
                "value" : "TETANUS TOXOID, REDUCED DIPHTHERIA TOXOID AND ACELLULAR PERTUSSIS VACCINE, ADSORBED"
              }
            ]
          },
          {
            "code" : "58160-0842-05",
            "display" : "BOOSTRIX",
            "designation" : [
              {
                "value" : "TETANUS TOXOID, REDUCED DIPHTHERIA TOXOID AND ACELLULAR PERTUSSIS VACCINE, ADSORBED"
              }
            ]
          },
          {
            "code" : "66019-0300-01",
            "display" : "FluMist Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "49281-0589-58",
            "display" : "Menactra",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS GROUP A CAPSULAR POLYSACCHARIDE DIPHTHERIA TOXOID CONJUGATE ANTIGEN, NEISSERI"
              }
            ]
          },
          {
            "code" : "00006-4095-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "00006-4096-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "00006-4831-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "63851-0511-11",
            "display" : "RabAvert",
            "designation" : [
              {
                "value" : "RABIES VACCINE"
              }
            ]
          },
          {
            "code" : "66019-0200-01",
            "display" : "Influenza A H1N1 2009 Monovalent Vaccine Live Intr",
            "designation" : [
              {
                "value" : "INFLUENZA A H1N1 2009 MONOVALENT VACCINE LIVE INTRANASAL"
              }
            ]
          },
          {
            "code" : "14362-0111-03",
            "display" : "Tetanus and Diphtheria Toxoids Adsorbed",
            "designation" : [
              {
                "value" : "TETANUS AND DIPHTHERIA TOXOIDS ADSORBED"
              }
            ]
          },
          {
            "code" : "33332-0519-01",
            "display" : "Influenza A",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "33332-0519-25",
            "display" : "Influenza A",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "33332-0629-10",
            "display" : "Influenza A",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "58160-0825-43",
            "display" : "HAVRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0825-01",
            "display" : "HAVRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0826-43",
            "display" : "HAVRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0826-05",
            "display" : "HAVRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0826-01",
            "display" : "HAVRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE"
              }
            ]
          },
          {
            "code" : "33332-0010-01",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "33332-0110-10",
            "display" : "AFLURIA",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-181 (H1N1) HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "66521-0115-10",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "Influenza Virus Vaccine"
              }
            ]
          },
          {
            "code" : "66521-0115-02",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "00006-4133-01",
            "display" : "Tetanus and Diphtheria Toxoids Adsorbed",
            "designation" : [
              {
                "value" : "TETANUS AND DIPHTHERIA TOXOIDS ADSORBED"
              }
            ]
          },
          {
            "code" : "54868-4320-09",
            "display" : "PNEUMOVAX 23",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL VACCINE POLYVALENT"
              }
            ]
          },
          {
            "code" : "54868-3339-09",
            "display" : "PNEUMOVAX 23",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL VACCINE POLYVALENT"
              }
            ]
          },
          {
            "code" : "00052-0603-01",
            "display" : "BCG VACCINE",
            "designation" : [
              {
                "value" : "BACILLUS CALMETTE-GUERIN SUBSTRAIN TICE LIVE ANTIGEN"
              }
            ]
          },
          {
            "code" : "64678-0211-05",
            "display" : "BioThrax",
            "designation" : [
              {
                "value" : "BACILLUS ANTHRACIS"
              }
            ]
          },
          {
            "code" : "00006-4739-01",
            "display" : "PNEUMOVAX 23",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL VACCINE POLYVALENT"
              }
            ]
          },
          {
            "code" : "00006-4943-01",
            "display" : "PNEUMOVAX 23",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL VACCINE POLYVALENT"
              }
            ]
          },
          {
            "code" : "49281-0013-58",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0013-88",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0392-78",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0113-00",
            "display" : "FLUZONE",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009 X-179A (H1N1) ANTIGEN (FORMALDEHYDE INACTIVATED), INFLUENZA A"
              }
            ]
          },
          {
            "code" : "49281-0820-10",
            "display" : "TETANUS TOXOID ADSORBED",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0800-83",
            "display" : "TETANUS TOXOID ADSORBED",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0400-88",
            "display" : "Adacel",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CORYNEBACTERIUM DIPHTHERIAE TOXOID ANT"
              }
            ]
          },
          {
            "code" : "49281-0286-58",
            "display" : "DAPTACEL",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CLOSTRIDIUM TETANI TOXOID ANT"
              }
            ]
          },
          {
            "code" : "49281-0286-58",
            "display" : "DAPTACEL",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CLOSTRIDIUM TETANI TOXOID ANT"
              }
            ]
          },
          {
            "code" : "49281-0286-58",
            "display" : "DAPTACEL",
            "designation" : [
              {
                "value" : "CORYNEBACTERIUM DIPHTHERIAE TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CLOSTRIDIUM TETANI TOXOID ANT"
              }
            ]
          },
          {
            "code" : "58160-0815-41",
            "display" : "TWINRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0815-43",
            "display" : "TWINRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0815-05",
            "display" : "TWINRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0815-43",
            "display" : "TWINRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "58160-0815-01",
            "display" : "TWINRIX",
            "designation" : [
              {
                "value" : "HEPATITIS A AND HEPATITIS B (RECOMBINANT) VACCINE"
              }
            ]
          },
          {
            "code" : "66521-0114-10",
            "display" : "Fluvirin",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CHRISTCHURCH/16/2010 NIB-74 (H1N1) ANTIGEN (PROPIOLACTONE INACTIVATED), INFLUENZ"
              }
            ]
          },
          {
            "code" : "76420-0482-01",
            "display" : "FLUVIRIN",
            "designation" : [
              {
                "value" : "INFLUENZA A VIRUS A/CALIFORNIA/7/2009(H1N1)-LIKE HEMAGGLUTININ ANTIGEN (PROPIOLACTONE INACTIVATED),"
              }
            ]
          },
          {
            "code" : "19515-0895-01",
            "display" : "Flulaval Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "00006-4999-01",
            "display" : "ProQuad",
            "designation" : [
              {
                "value" : "MEASLES, MUMPS, RUBELLA AND VARICELLA VIRUS VACCINE LIVE"
              }
            ]
          },
          {
            "code" : "49281-0545-15",
            "display" : "ACTHIB",
            "designation" : [
              {
                "value" : "HAEMOPHILUS B CONJUGATE VACCINE (TETANUS TOXOID CONJUGATE)"
              }
            ]
          },
          {
            "code" : "51285-0174-02",
            "display" : "Adenovirus Type 4 Vaccine, Live, Oral",
            "designation" : [
              {
                "value" : "ADENOVIRUS TYPE 4 VACCINE, LIVE, ORAL"
              }
            ]
          },
          {
            "code" : "49281-0248-58",
            "display" : "IMOVAX RABIES",
            "designation" : [
              {
                "value" : "RABIES VIRUS STRAIN PM-1503-3M ANTIGEN (PROPIOLACTONE INACTIVATED)"
              }
            ]
          },
          {
            "code" : "49281-0487-58",
            "display" : "MENOMUNE - A/C/Y/W-135 COMBINED",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS GROUP A CAPSULAR POLYSACCHARIDE ANTIGEN, NEISSERIA MENINGITIDIS GROUP C CAPSU"
              }
            ]
          },
          {
            "code" : "49281-0915-58",
            "display" : "YF-VAX",
            "designation" : [
              {
                "value" : "YELLOW FEVER VIRUS LIVE ANTIGEN, A"
              }
            ]
          },
          {
            "code" : "49281-0547-58",
            "display" : "ACTHIB",
            "designation" : [
              {
                "value" : "HAEMOPHILUS INFLUENZAE TYPE B STRAIN 1482 CAPSULAR POLYSACCHARIDE TETANUS TOXOID CONJUGATE ANTIGEN"
              }
            ]
          },
          {
            "code" : "58160-0851-01",
            "display" : "ROTARIX",
            "designation" : [
              {
                "value" : "ROTAVIRUS VACCINE, LIVE, ORAL"
              }
            ]
          },
          {
            "code" : "49281-0915-68",
            "display" : "YF-VAX",
            "designation" : [
              {
                "value" : "YELLOW FEVER VIRUS LIVE ANTIGEN, A"
              }
            ]
          },
          {
            "code" : "49281-0488-78",
            "display" : "MENOMUNE - A/C/Y/W-135 COMBINED",
            "designation" : [
              {
                "value" : "NEISSERIA MENINGITIDIS GROUP A POLYSACCHARIDE ANTIGEN, A, NEISSERIA MENINGITIDIS GROUP C POLYSACCHAR"
              }
            ]
          },
          {
            "code" : "46028-0219-11",
            "display" : "Meningococcal (Groups C, Y, W-135) CRM197 Oligosac",
            "designation" : [
              {
                "value" : "MENC, Y, W-135 VACCINE"
              }
            ]
          },
          {
            "code" : "51285-0175-02",
            "display" : "Adenovirus Type 7 Vaccine, Live, Oral",
            "designation" : [
              {
                "value" : "ADENOVIRUS TYPE 7 VACCINE, LIVE, ORAL"
              }
            ]
          },
          {
            "code" : "49281-0560-05",
            "display" : "DTAP-IPV",
            "designation" : [
              {
                "value" : "DIPHTHERIA AND TETANUS TOXOIDS AND ACELLULAR PERTUSSIS ADSORBED, INACTIVATED POLIOVIRUS"
              }
            ]
          },
          {
            "code" : "49281-0400-58",
            "display" : "Adacel",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CORYNEBACTERIUM DIPHTHERIAE TOXOID ANT"
              }
            ]
          },
          {
            "code" : "49281-0400-58",
            "display" : "Adacel",
            "designation" : [
              {
                "value" : "CLOSTRIDIUM TETANI TOXOID ANTIGEN (FORMALDEHYDE INACTIVATED), CORYNEBACTERIUM DIPHTHERIAE TOXOID ANT"
              }
            ]
          },
          {
            "code" : "42874-0013-01",
            "display" : "Flublok",
            "designation" : [
              {
                "value" : "INFLUENZA VACCINE"
              }
            ]
          },
          {
            "code" : "66521-0116-11",
            "display" : "FLUVIRIN",
            "designation" : [
              {
                "value" : "influenza a virus a/christchurch , influenza a virus a/texas , influenza b virus b/massachusetts"
              }
            ]
          },
          {
            "code" : "66521-0116-12",
            "display" : "FLUVIRIN",
            "designation" : [
              {
                "value" : "influenza a virus a/christchurch , influenza a virus a/texas , influenza b virus b/massachusetts"
              }
            ]
          },
          {
            "code" : "00006-4045-01",
            "display" : "GARDASIL",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS QUADRIVALENT (TYPES 6, 11, 16, AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "00006-4045-01",
            "display" : "GARDASIL",
            "designation" : [
              {
                "value" : "HUMAN PAPILLOMAVIRUS QUADRIVALENT (TYPES 6, 11, 16, AND 18) VACCINE, RECOMBINANT"
              }
            ]
          },
          {
            "code" : "00006-4995-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4995-01",
            "display" : "RECOMBIVAX HB",
            "designation" : [
              {
                "value" : "HEPATITIS B VACCINE (RECOMBINANT)"
              }
            ]
          },
          {
            "code" : "00006-4841-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "00006-4841-01",
            "display" : "VAQTA",
            "designation" : [
              {
                "value" : "HEPATITIS A VACCINE, INACTIVATED"
              }
            ]
          },
          {
            "code" : "58160-0804-01",
            "display" : "INFLUENZA (H5N1), adjuvanted",
            "designation" : [
              {
                "value" : "INFLUENZA (H5N1) MONOVALENT, ADJUVANTED"
              }
            ]
          },
          {
            "code" : "58160-0802-02",
            "display" : "AS03 Adjuvant",
            "designation" : [
              {
                "value" : "Adjuvant"
              }
            ]
          },
          {
            "code" : "58160-0901-41",
            "display" : "FLUARIX QUADRIVALENT",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "00006-4837-01",
            "display" : "PNEUMOVAX 23",
            "designation" : [
              {
                "value" : "PNEUMOCOCCAL VACCINE POLYVALENT"
              }
            ]
          },
          {
            "code" : "19515-0891-01",
            "display" : "Flulaval Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "19515-0893-02",
            "display" : "FLULAVAL",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "19515-0894-41",
            "display" : "Flulaval Quadrivalent",
            "designation" : [
              {
                "value" : "INFLUENZA VIRUS VACCINE"
              }
            ]
          },
          {
            "code" : "49281-0514-00",
            "display" : "Fluzone Quadrivalent, Peds"
          },
          {
            "code" : "49281-0394-78",
            "display" : "FLUZONE"
          },
          {
            "code" : "49281-0014-88",
            "display" : "FLUZONE"
          },
          {
            "code" : "49281-0414-58",
            "display" : "FLUZONE QUADRIVALENT PF"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-narrative-status" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Narrative Status

This value set limits the text status for the resource narrative.

Copyright Statement: HL7

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/narrative-status
    CodeDisplay
    additionaladditionalThe contents of the narrative may contain additional information not found in the structured data. Note that there is no computable way to determine what the extra information is, other than by human inspection.
    generatedgeneratedThe contents of the narrative are entirely generated from the structured data in the content.

{
  "resourceType" : "ValueSet",
  "id" : "us-core-narrative-status",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.062Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Narrative Status</h2><div><p>This value set limits the text status for the resource narrative.</p>\n</div><p><b>Copyright Statement:</b> HL7</p><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"http://build.fhir.org/codesystem-narrative-status.html\"><code>http://hl7.org/fhir/narrative-status</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"http://build.fhir.org/codesystem-narrative-status.html#narrative-status-additional\">additional</a></td><td>additional</td><td>The contents of the narrative may contain additional information not found in the structured data. Note that there is no computable way to determine what the extra information is, other than by human inspection.</td></tr><tr><td><a href=\"http://build.fhir.org/codesystem-narrative-status.html#narrative-status-generated\">generated</a></td><td>generated</td><td>The contents of the narrative are entirely generated from the structured data in the content.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-narrative-status",
  "version" : "2.0.0",
  "name" : "Narrative Status",
  "status" : "draft",
  "date" : "2018-08-21T01:46:22+00:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set limits the text status for the resource narrative.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "HL7",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/narrative-status",
        "concept" : [
          {
            "code" : "additional",
            "display" : "additional"
          },
          {
            "code" : "generated",
            "display" : "generated"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-medication-codes" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Medication Clinical Drug (RxNorm)

All prescribable medication formulations represented using either a 'generic' or 'brand-specific' concept. This includes RxNorm codes whose Term Type is SCD (semantic clinical drug), SBD (semantic brand drug), GPCK (generic pack), BPCK (brand pack), SCDG (semantic clinical drug group), SBDG (semantic brand drug group), SCDF (semantic clinical drug form), or SBDF (semantic brand drug form)

This value set includes codes from the following code systems:

  • Include codes from http://www.nlm.nih.gov/research/umls/rxnorm where TTY in SCD,SBD,GPCK,BPCK,SCDG,SBDG,SCDF,SBDF

{
  "resourceType" : "ValueSet",
  "id" : "us-core-medication-codes",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:46.015Z",
    "profile" : [
      "http://hl7.org/fhir/StructureDefinition/valueset-shareable-definition"
    ]
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">\n <h2>Medication Clinical Drug (RxNorm)</h2>\n <p>All prescribable medication formulations represented using either a 'generic' or 'brand-specific' concept. This includes RxNorm codes whose Term Type is SCD (semantic clinical drug), SBD (semantic brand drug), GPCK (generic pack), BPCK (brand pack), SCDG (semantic clinical drug group), SBDG (semantic brand drug group), SCDF (semantic clinical drug form), or SBDF (semantic brand drug form)</p>\n <p>This value set includes codes from the following code systems:</p>\n <ul>\n <li>Include codes from http://www.nlm.nih.gov/research/umls/rxnorm where TTY in SCD,SBD,GPCK,BPCK,SCDG,SBDG,SCDF,SBDF</li>\n </ul>\n </div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-medication-codes",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113762.1.4.1010.4"
    }
  ],
  "version" : "2.0.0",
  "name" : "Medication Clinical Drug (RxNorm)",
  "status" : "draft",
  "date" : "2016-05-25T16:59:08+10:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "All prescribable medication formulations represented using either a 'generic' or 'brand-specific' concept. This includes RxNorm codes whose Term Type is SCD (semantic clinical drug), SBD (semantic brand drug), GPCK (generic pack), BPCK (brand pack), SCDG (semantic clinical drug group), SBDG (semantic brand drug group), SCDF (semantic clinical drug form), or SBDF (semantic brand drug form)",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "http://www.nlm.nih.gov/research/umls/rxnorm",
        "filter" : [
          {
            "property" : "TTY",
            "op" : "in",
            "value" : "SCD,SBD,GPCK,BPCK,SCDG,SBDG,SCDF,SBDF"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-encounter-type" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Encounter Type

The type of encounter: a specific code indicating type of service provided, from CPT

Copyright Statement: CPT copyright 2014 American Medical Association. All rights reserved.

This value set includes only the codes of the Current Procedure and Terminology designated for Evaluation and Management (99200 – 99607) (subscription to AMA Required) from code systems:

  • http://www.ama-assn.org/go/cpt

{
  "resourceType" : "ValueSet",
  "id" : "us-core-encounter-type",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.968Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\">\n&#9;&#9;&#9;<h2>US Core Encounter Type</h2>\n&#9;&#9;&#9;<p>The type of encounter: a specific code indicating type of service provided, from CPT</p>\n&#9;&#9;&#9;<p>\n&#9;&#9;&#9;&#9;<b>Copyright Statement:</b> CPT copyright 2014 American Medical Association. All rights reserved.\n&#9;&#9;&#9;</p>\n&#9;&#9;&#9;<p>This value set includes only the codes of the Current Procedure and Terminology designated for Evaluation and Management (99200 &#8211; 99607) (subscription to AMA Required) from code systems:</p>\n&#9;&#9;&#9;<ul>\n&#9;&#9;&#9;&#9;<li>http://www.ama-assn.org/go/cpt</li>\n&#9;&#9;&#9;</ul>\n&#9;&#9;</div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-encounter-type",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.3.88.12.80.32"
    }
  ],
  "version" : "2.0.0",
  "name" : "US Core Encounter Type",
  "status" : "draft",
  "date" : "2017-12-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "The type of encounter: a specific code indicating type of service provided, from CPT",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "copyright" : "CPT copyright 2014 American Medical Association. All rights reserved.",
  "compose" : {
    "include" : [
      {
        "system" : "http://www.ama-assn.org/go/cpt"
      }
    ]
  }
}

ValueSet "us-core-cvx" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Vaccine Administered Value Set (CVX)

This identifies the vaccine substance administered - CVX codes

This value set includes codes from the following code systems:

  • Include all codes defined in http://hl7.org/fhir/sid/cvx

{
  "resourceType" : "ValueSet",
  "id" : "us-core-cvx",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.937Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Vaccine Administered Value Set (CVX)</h2><div><p>This identifies the vaccine substance administered - CVX codes</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://hl7.org/fhir/sid/cvx</code></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-cvx",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.3.88.12.80.22"
    }
  ],
  "version" : "2.0.0",
  "name" : "Vaccine Administered Value Set (CVX)",
  "status" : "active",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This identifies the vaccine substance administered - CVX codes",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/sid/cvx"
      }
    ]
  }
}

ValueSet "us-core-condition-category" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Condition Category Codes

The US core Condition Category Codes support the separate concepts of problems and health concerns in Condition.category in order for API consumers to be able to separate health concerns and problems. However this is not mandatory for 2015 certification

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "us-core-condition-category",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.874Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Condition Category Codes</h2><div><p>The&#160;US core Condition Category Codes&#160;support the separate concepts of problems and health concerns in&#160;Condition.category&#160;in order for API consumers to be able to separate health concerns and problems. However this is not mandatory for 2015 certification</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://hl7.org/fhir/condition-category</code></li><li>Include these codes as defined in <a href=\"CodeSystem-condition-category.html\"><code>http://hl7.org/fhir/us/core-r4/CodeSystem/condition-category</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-condition-category.html#condition-category-health-concern\">health-concern</a></td><td>Health Concern</td><td>Additional health concerns from other stakeholders which are outside the provider&#8217;s problem list.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-condition-category",
  "version" : "2.0.0",
  "name" : "US Core Condition Category Codes",
  "status" : "draft",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "description" : "The US core Condition Category Codes support the separate concepts of problems and health concerns in Condition.category in order for API consumers to be able to separate health concerns and problems. However this is not mandatory for 2015 certification",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "purpose" : "So API consumers can separate health concerns and problems.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/condition-category"
      },
      {
        "system" : "http://hl7.org/fhir/us/core-r4/CodeSystem/condition-category",
        "concept" : [
          {
            "code" : "health-concern",
            "display" : "Health Concern"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-careteam-provider-roles" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

CareTeam Provider Roles

Provider roles codes consist of NUCC Health Care Provider Taxonomy Code Set for providers and SNOMED-CT for - non clinical and organization roles including codes from the SCTID 125676002 Person (person) heirarchy and the SCTID 394730007 Healthcare related organization (qualifier value) heirarchy.

Copyright Statement: This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement. This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright © 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.

This value set includes codes from the following code systems:

  • Include all codes defined in http://nucc.org/provider-taxonomy
  • Include codes from http://snomed.info/sct where concept is-a 125676002 (Person)
  • Include codes from http://snomed.info/sct where concept is-a 394730007 (Healthcare related organization)

{
  "resourceType" : "ValueSet",
  "id" : "us-core-careteam-provider-roles",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.827Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>CareTeam Provider Roles</h2><div><p>Provider roles codes consist of NUCC Health Care Provider Taxonomy Code Set for providers and SNOMED-CT for - non clinical and organization roles including codes from the SCTID 125676002 Person (person) heirarchy and the SCTID 394730007 Healthcare related organization (qualifier value) heirarchy.</p>\n</div><p><b>Copyright Statement:</b> This value set includes content from SNOMED CT, which is copyright &#169; 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement. This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright &#169; 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.</p><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <code>http://nucc.org/provider-taxonomy</code></li><li>Include codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 125676002 (Person)</li><li>Include codes from <a href=\"http://www.snomed.org/\"><code>http://snomed.info/sct</code></a> where concept is-a 394730007 (Healthcare related organization)</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-careteam-provider-roles",
  "version" : "2.0.0",
  "name" : "CareTeam Provider Roles",
  "status" : "draft",
  "date" : "2016-08-08T08:27:28-07:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Provider roles codes consist of NUCC Health Care Provider Taxonomy Code Set for providers and SNOMED-CT for - non clinical and organization roles including codes from the SCTID 125676002 Person (person) heirarchy and the SCTID 394730007 Healthcare related organization (qualifier value) heirarchy.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "purpose" : "Codes that may be used for implementation of the Argonaut Procedures IG and MU2015 certification.",
  "copyright" : "This value set includes content from SNOMED CT, which is copyright © 2002+ International Health Terminology Standards Development Organisation (IHTSDO), and distributed by agreement between IHTSDO and HL7. Implementer use of SNOMED CT is not covered by this agreement. This value set includes content from NUCC Health Care Provider Taxonomy Code Set for providers which is copyright © 2016+ American Medical Association. For commercial use, including sales or licensing, a license must be obtained.",
  "compose" : {
    "include" : [
      {
        "system" : "http://nucc.org/provider-taxonomy"
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "125676002"
          }
        ]
      },
      {
        "system" : "http://snomed.info/sct",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "394730007"
          }
        ]
      }
    ]
  }
}

ValueSet "us-core-birthsex" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US Core Birth Sex Value Set

Codes for assigning sex at birth as specified by the Office of the National Coordinator for Health IT (ONC)

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/v3/AdministrativeGender
    CodeDisplay
    FFemale
    MMale
  • Include these codes as defined in http://hl7.org/fhir/v3/NullFlavor
    CodeDisplay
    UNKUnknown

{
  "resourceType" : "ValueSet",
  "id" : "us-core-birthsex",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.781Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US Core Birth Sex Value Set</h2><div><p>Codes for assigning sex at birth as specified by the <a href=\"https://www.healthit.gov/newsroom/about-onc\">Office of the National Coordinator for Health IT (ONC)</a></p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <code>http://hl7.org/fhir/v3/AdministrativeGender</code><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td>F</td><td>Female</td><td/></tr><tr><td>M</td><td>Male</td><td/></tr></table></li><li>Include these codes as defined in <code>http://hl7.org/fhir/v3/NullFlavor</code><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td>UNK</td><td>Unknown</td><td/></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/us-core-birthsex",
  "version" : "2.0.0",
  "name" : "US Core Birth Sex Value Set",
  "status" : "active",
  "date" : "2016-08-10",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for assigning sex at birth as specified by the [Office of the National Coordinator for Health IT (ONC)](https://www.healthit.gov/newsroom/about-onc)",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/v3/AdministrativeGender",
        "concept" : [
          {
            "code" : "F",
            "display" : "Female"
          },
          {
            "code" : "M",
            "display" : "Male"
          }
        ]
      },
      {
        "system" : "http://hl7.org/fhir/v3/NullFlavor",
        "concept" : [
          {
            "code" : "UNK",
            "display" : "Unknown"
          }
        ]
      }
    ]
  }
}

ValueSet "simple-language" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

Language codes with language and optionally a region modifier

This value set includes codes from BCP-47. This value set matches the ONC 2015 Edition LanguageCommunication data element value set within C-CDA to use a 2 character language code if one exists, and a 3 character code if a 2 character code does not exist. It points back to RFC 5646, however only the language codes are required, all other elements are optional.

This value set includes codes from the following code systems:

  • Include codes from urn:ietf:bcp:47 where ext-lang exists false and urn:ietf:bcp:47 where script exists false and urn:ietf:bcp:47 where variant exists false and urn:ietf:bcp:47 where extension exists false and urn:ietf:bcp:47 where private-use exists false

{
  "resourceType" : "ValueSet",
  "id" : "simple-language",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.734Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>Language codes with language and optionally a region modifier</h2><div><p>This value set includes codes from <a href=\"http://tools.ietf.org/html/bcp47\">BCP-47</a>. This value set matches the ONC 2015 Edition LanguageCommunication data element value set within C-CDA to use a 2 character language code if one exists, and a 3 character code if a 2 character code does not exist. It points back to <a href=\"https://tools.ietf.org/html/rfc5646\">RFC 5646</a>, however only the language codes are required, all other elements are optional.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <code>urn:ietf:bcp:47</code> where ext-lang exists false and <code>urn:ietf:bcp:47</code> where script exists false and <code>urn:ietf:bcp:47</code> where variant exists false and <code>urn:ietf:bcp:47</code> where extension exists false and <code>urn:ietf:bcp:47</code> where private-use exists false</li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/simple-language",
  "version" : "2.0.0",
  "name" : "Language codes with language and optionally a region modifier",
  "status" : "draft",
  "date" : "2017-02-28",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "url",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set includes codes from [BCP-47](http://tools.ietf.org/html/bcp47). This value set matches the ONC 2015 Edition LanguageCommunication data element value set within C-CDA to use a 2 character language code if one exists, and a 3 character code if a 2 character code does not exist. It points back to [RFC 5646](https://tools.ietf.org/html/rfc5646), however only the language codes are required, all other elements are optional.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "urn:ietf:bcp:47",
        "filter" : [
          {
            "property" : "ext-lang",
            "op" : "exists",
            "value" : "false"
          },
          {
            "property" : "script",
            "op" : "exists",
            "value" : "false"
          },
          {
            "property" : "variant",
            "op" : "exists",
            "value" : "false"
          },
          {
            "property" : "extension",
            "op" : "exists",
            "value" : "false"
          },
          {
            "property" : "private-use",
            "op" : "exists",
            "value" : "false"
          }
        ]
      }
    ]
  }
}

ValueSet "omb-race-category" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

OMB Race Categories

The codes for the concepts 'Unknown' and 'Asked but no answer' and the the codes for the five race categories - 'American Indian' or 'Alaska Native', 'Asian', 'Black or African American', 'Native Hawaiian or Other Pacific Islander', and 'White' - as defined by the OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997 .

This value set includes codes from the following code systems:

  • Include these codes as defined in urn:oid:2.16.840.1.113883.6.238
    CodeDisplay
    1002-5American Indian or Alaska NativeAmerican Indian or Alaska Native
    2028-9AsianAsian
    2054-5Black or African AmericanBlack or African American
    2076-8Native Hawaiian or Other Pacific IslanderNative Hawaiian or Other Pacific Islander
    2106-3WhiteWhite
  • Include these codes as defined in http://hl7.org/fhir/v3/NullFlavor
    CodeDisplay
    UNKUnknown
    ASKUAsked but no answer

{
  "resourceType" : "ValueSet",
  "id" : "omb-race-category",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.140Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>OMB Race Categories</h2><div><p>The codes for the concepts 'Unknown' and 'Asked but no answer' and the the codes for the five race categories - 'American Indian' or 'Alaska Native', 'Asian', 'Black or African American', 'Native Hawaiian or Other Pacific Islander', and 'White' - as defined by the <a href=\"https://www.whitehouse.gov/omb/fedreg_1997standards\">OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997</a> .</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-1002-5\">1002-5</a></td><td>American Indian or Alaska Native</td><td>American Indian or Alaska Native</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2028-9\">2028-9</a></td><td>Asian</td><td>Asian</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2054-5\">2054-5</a></td><td>Black or African American</td><td>Black or African American</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2076-8\">2076-8</a></td><td>Native Hawaiian or Other Pacific Islander</td><td>Native Hawaiian or Other Pacific Islander</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2106-3\">2106-3</a></td><td>White</td><td>White</td></tr></table></li><li>Include these codes as defined in <code>http://hl7.org/fhir/v3/NullFlavor</code><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td>UNK</td><td>Unknown</td><td/></tr><tr><td>ASKU</td><td>Asked but no answer</td><td/></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/omb-race-category",
  "identifier" : [
    {
      "system" : "urn:ietf:rfc:3986",
      "value" : "urn:oid:2.16.840.1.113883.4.642.2.575"
    }
  ],
  "version" : "2.0.0",
  "name" : "OMB Race Categories",
  "status" : "active",
  "date" : "2016-05-25T16:59:08+10:00",
  "publisher" : "HL7 US Realm Steering Committee",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    },
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://wiki.siframework.org/Data+Access+Framework+Homepage"
        }
      ]
    }
  ],
  "description" : "The codes for the concepts 'Unknown' and 'Asked but no answer' and the the codes for the five race categories - 'American Indian' or 'Alaska Native', 'Asian', 'Black or African American', 'Native Hawaiian or Other Pacific Islander', and 'White' - as defined by the [OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997](https://www.whitehouse.gov/omb/fedreg_1997standards) .",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "concept" : [
          {
            "code" : "1002-5",
            "display" : "American Indian or Alaska Native"
          },
          {
            "code" : "2028-9",
            "display" : "Asian"
          },
          {
            "code" : "2054-5",
            "display" : "Black or African American"
          },
          {
            "code" : "2076-8",
            "display" : "Native Hawaiian or Other Pacific Islander"
          },
          {
            "code" : "2106-3",
            "display" : "White"
          }
        ]
      },
      {
        "system" : "http://hl7.org/fhir/v3/NullFlavor",
        "concept" : [
          {
            "code" : "UNK",
            "display" : "Unknown"
          },
          {
            "code" : "ASKU",
            "display" : "Asked but no answer"
          }
        ]
      }
    ]
  }
}

ValueSet "omb-ethnicity-category" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

OMB Ethnicity Categories

The codes for the ethnicity categories - 'Hispanic or Latino' and 'Non Hispanic or Latino' - as defined by the OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997.

This value set includes codes from the following code systems:

  • Include these codes as defined in urn:oid:2.16.840.1.113883.6.238
    CodeDisplay
    2135-2Hispanic or LatinoHispanic or Latino
    2186-5Non Hispanic or LatinoNote that this term remains in the table for completeness, even though within HL7, the notion of "not otherwise coded" term is deprecated.

{
  "resourceType" : "ValueSet",
  "id" : "omb-ethnicity-category",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.109Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>OMB Ethnicity Categories</h2><div><p>The codes for the ethnicity categories - 'Hispanic or Latino' and 'Non Hispanic or Latino' - as defined by the <a href=\"https://www.whitehouse.gov/omb/fedreg_1997standards\">OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997</a>.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2135-2\">2135-2</a></td><td>Hispanic or Latino</td><td>Hispanic or Latino</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2186-5\">2186-5</a></td><td>Non Hispanic or Latino</td><td>Note that this term remains in the table for completeness, even though within HL7, the notion of \"not otherwise coded\" term is deprecated.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/omb-ethnicity-category",
  "version" : "2.0.0",
  "name" : "OMB Ethnicity Categories",
  "status" : "draft",
  "date" : "2016-08-30",
  "publisher" : "HL7 US Realm Steering Committee",
  "description" : "The codes for the ethnicity categories - 'Hispanic or Latino' and 'Non Hispanic or Latino' - as defined by the [OMB Standards for Maintaining, Collecting, and Presenting Federal Data on Race and Ethnicity, Statistical Policy Directive No. 15, as revised, October 30, 1997](https://www.whitehouse.gov/omb/fedreg_1997standards).",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "concept" : [
          {
            "code" : "2135-2",
            "display" : "Hispanic or Latino"
          },
          {
            "code" : "2186-5",
            "display" : "Non Hispanic or Latino"
          }
        ]
      }
    ]
  }
}

ValueSet "detailed-race" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US-Core Detailed Race

The 900+ CDC Race codes that are grouped under one of the 5 OMB race category codes.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "detailed-race",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:45.062Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US-Core Detailed Race</h2><div><p>The 900+ <a href=\"http://www.cdc.gov/phin/resources/vocabulary/index.html\">CDC Race codes</a> that are grouped under one of the 5 OMB race category codes.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a> where concept is-a <a href=\"CodeSystem-cdcrec.html#cdcrec-1000-9\">1000-9</a></li><li>Exclude these codes as defined in <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-1002-5\">1002-5</a></td><td>American Indian or Alaska Native</td><td>American Indian or Alaska Native</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2028-9\">2028-9</a></td><td>Asian</td><td>Asian</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2054-5\">2054-5</a></td><td>Black or African American</td><td>Black or African American</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2076-8\">2076-8</a></td><td>Native Hawaiian or Other Pacific Islander</td><td>Native Hawaiian or Other Pacific Islander</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2106-3\">2106-3</a></td><td>White</td><td>White</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/detailed-race",
  "version" : "2.0.0",
  "name" : "US-Core Detailed Race",
  "status" : "draft",
  "date" : "2016-08-30",
  "publisher" : "HL7 US Realm Steering Committee",
  "description" : "The 900+ [CDC Race codes](http://www.cdc.gov/phin/resources/vocabulary/index.html) that are grouped under one of the 5 OMB race category codes.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "1000-9"
          }
        ]
      }
    ],
    "exclude" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "concept" : [
          {
            "code" : "1002-5"
          },
          {
            "code" : "2028-9"
          },
          {
            "code" : "2054-5"
          },
          {
            "code" : "2076-8"
          },
          {
            "code" : "2106-3"
          }
        ]
      }
    ]
  }
}

ValueSet "detailed-ethnicity" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

US-Core Detailed ethnicity

The 41 CDC ethnicity codes that are grouped under one of the 2 OMB ethnicity category codes.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "detailed-ethnicity",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:44.984Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>US-Core Detailed ethnicity</h2><div><p>The 41 <a href=\"http://www.cdc.gov/phin/resources/vocabulary/index.html\">CDC ethnicity codes</a> that are grouped under one of the 2 OMB ethnicity category codes.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include codes from <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a> where concept is-a <a href=\"CodeSystem-cdcrec.html#cdcrec-2133-7\">2133-7</a></li><li>Exclude these codes as defined in <a href=\"CodeSystem-cdcrec.html\"><code>urn:oid:2.16.840.1.113883.6.238</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2135-2\">2135-2</a></td><td>Hispanic or Latino</td><td>Hispanic or Latino</td></tr><tr><td><a href=\"CodeSystem-cdcrec.html#cdcrec-2186-5\">2186-5</a></td><td>Not Hispanic or Latino</td><td>Note that this term remains in the table for completeness, even though within HL7, the notion of \"not otherwise coded\" term is deprecated.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/us/core-r4/ValueSet/detailed-ethnicity",
  "version" : "2.0.0",
  "name" : "US-Core Detailed ethnicity",
  "status" : "draft",
  "date" : "2016-08-30",
  "publisher" : "HL7 US Realm Steering Committee",
  "description" : "The 41 [CDC ethnicity codes](http://www.cdc.gov/phin/resources/vocabulary/index.html) that are grouped under one of the 2 OMB ethnicity category codes.",
  "jurisdiction" : [
    {
      "coding" : [
        {
          "system" : "urn:iso:std:iso:3166",
          "code" : "US",
          "display" : "United States of America"
        }
      ]
    }
  ],
  "compose" : {
    "include" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "filter" : [
          {
            "property" : "concept",
            "op" : "is-a",
            "value" : "2133-7"
          }
        ]
      }
    ],
    "exclude" : [
      {
        "system" : "urn:oid:2.16.840.1.113883.6.238",
        "concept" : [
          {
            "code" : "2135-2"
          },
          {
            "code" : "2186-5"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-validationprocess" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Validation Process

Documents the external source validation requirements for this element or set of elements.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    editcheckEdit checkIndicates the element or resource is validated for format, range, presence, or other similar properties.
    valuesetValuesetIndicates the element or resource is validated against a value set.
    extsourceExternal sourceIndicates the element or resource is validated against an external source.
    standaloneStand aloneIndicates the element or resource is validated by itself and is unrelated to other elements or resources.
    incontextIn contextIndicates the element or resource is validated by the existence or value of another related element or resource.
    attesterAttesterAttester

{
  "resourceType" : "ValueSet",
  "id" : "valueset-validationprocess",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.937Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Validation Process</h2><div><p>Documents the external source validation requirements for this element or set of elements.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-editcheck\">editcheck</a></td><td>Edit check</td><td>Indicates the element or resource is validated for format, range, presence, or other similar properties.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-valueset\">valueset</a></td><td>Valueset</td><td>Indicates the element or resource is validated against a value set.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-extsource\">extsource</a></td><td>External source</td><td>Indicates the element or resource is validated against an external source.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-standalone\">standalone</a></td><td>Stand alone</td><td>Indicates the element or resource is validated by itself and is unrelated to other elements or resources.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-incontext\">incontext</a></td><td>In context</td><td>Indicates the element or resource is validated by the existence or value of another related element or resource.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-attester\">attester</a></td><td>Attester</td><td>Attester</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-validationprocess",
  "version" : "0.2.0",
  "name" : "VhDirValidationProcess",
  "title" : "VhDir Validation Process",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Documents the external source validation requirements for this element or set of elements.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "editcheck"
          },
          {
            "code" : "valueset"
          },
          {
            "code" : "extsource"
          },
          {
            "code" : "standalone"
          },
          {
            "code" : "incontext"
          },
          {
            "code" : "attester"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-validationneed" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Validation Need

Attested information may require validation once, on a periodic basis, or in the case of information that is only self attested no validation at all. This value set defines a set of codes that describe how often validation is needed, if at all.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    noneneededNone neededNo validation needed/planned for this resource or element.
    initialInitialValidation is only needed after initial attestation. For elements that typically do not change such as 'medical school attended and graduation date'.
    periodicPeriodicValidation is needed after initial attestation and on a periodic basis. E.g. elements that expire or may change such as licensure.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-validationneed",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.874Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Validation Need</h2><div><p>Attested information may require validation once, on a periodic basis, or in the case of information that is only self attested no validation at all. This value set defines a set of codes that describe how often validation is needed, if at all.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-noneneeded\">noneneeded</a></td><td>None needed</td><td>No validation needed/planned for this resource or element.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-initial\">initial</a></td><td>Initial</td><td>Validation is only needed after initial attestation. For elements that typically do not change such as 'medical school attended and graduation date'.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-periodic\">periodic</a></td><td>Periodic</td><td>Validation is needed after initial attestation and on a periodic basis. E.g. elements that expire or may change such as licensure.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-validationneed",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourceValidationNeed",
  "title" : "VhDir Primary Source Validation Need",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Attested information may require validation once, on a periodic basis, or in the case of information that is only self attested no validation at all. This value set defines a set of codes that describe how often validation is needed, if at all.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "noneneeded"
          },
          {
            "code" : "initial"
          },
          {
            "code" : "periodic"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-usecasetype" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Use Case Type

Codes for documenting business use case by a general grouping by business area.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-usecasetype",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.812Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Use Case Type</h2><div><p>Codes for documenting business use case by a general grouping by business area.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <a href=\"CodeSystem-codesystem-usecase.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-usecase</code></a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-usecasetype",
  "version" : "0.2.0",
  "name" : "VhDirUseCaseType",
  "title" : "VhDir Use Case Type",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for documenting business use case by a general grouping by business area.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-usecase"
      }
    ]
  }
}

ValueSet "valueset-qualificationstatus" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Qualification Status

Codes for documenting the status of a qualification.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-qualificationstatus",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.749Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Qualification Status</h2><div><p>Codes for documenting the status of a qualification.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <a href=\"CodeSystem-codesystem-credentialstatus.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-credentialstatus</code></a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-qualificationstatus",
  "version" : "0.2.0",
  "name" : "VhDirQualificationStatus",
  "title" : "VhDir Qualification Status",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for documenting the status of a qualification.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-credentialstatus"
      }
    ]
  }
}

ValueSet "valueset-primarysourcevalidationstatus" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Validation Status

This value set defines a set of codes that indicate various states in the validation process that a given that a resource or element may be in at a point in time.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    successfulSuccessfulThe validation process is complete and a determination made that the the attested data is true and accurate.
    failedFailedThe validation process is complete and a determination made that the the attested data is not true or accurate.
    undeterminedUndeterminedThe validation process is complete and a determination could not be made that the the attested data is, or is not, true and accurate.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcevalidationstatus",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.702Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Validation Status</h2><div><p>This value set defines a set of codes that indicate various states in the validation process that a given that a resource or element may be in at a point in time.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-successful\">successful</a></td><td>Successful</td><td>The validation process is complete and a determination made that the the attested data is true and accurate.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-failed\">failed</a></td><td>Failed</td><td>The validation process is complete and a determination made that the the attested data is not true or accurate.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-undetermined\">undetermined</a></td><td>Undetermined</td><td>The validation process is complete and a determination could not be made that the the attested data is, or is not, true and accurate.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcevalidationstatus",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourceValidationStatus",
  "title" : "VhDir Primary Source Validation Status",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate various states in the validation process that a given that a resource or element may be in at a point in time.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "successful"
          },
          {
            "code" : "failed"
          },
          {
            "code" : "undetermined"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-primarysourcevalidationprocess" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Validation Process

Attested information may be validated by process that are manual or automated. For automated processes it may accomplished by the system of record reaching out through another system's API or information may be sent to the system of record. This value set defines a set of codes to describing the process, the how, a resource or data element is validated.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    manualManualThe resource or element is validated manually.
    portalPortalThe resource or element is validated via a portal into a source of valid data.
    pullPullData is retrieved (i.e. pulled) from a source of valid data into the Healthcare Directory
    pushPushData is sent (i.e. pushed) from a source of valid data to the Healthcare Directory

{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcevalidationprocess",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.656Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Validation Process</h2><div><p>Attested information may be validated by process that are manual or automated. For automated processes it may accomplished by the system of record reaching out through another system's API or information may be sent to the system of record. This value set defines a set of codes to describing the process, the how, a resource or data element is validated.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-manual\">manual</a></td><td>Manual</td><td>The resource or element is validated manually.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-portal\">portal</a></td><td>Portal</td><td>The resource or element is validated via a portal into a source of valid data.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-pull\">pull</a></td><td>Pull</td><td>Data is retrieved (i.e. pulled) from a source of valid data into the Healthcare Directory</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-push\">push</a></td><td>Push</td><td>Data is sent (i.e. pushed) from a source of valid data to the Healthcare Directory</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcevalidationprocess",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourceValidationProcess",
  "title" : "VhDir Primary Source Validation Process",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Attested information may be validated by process that are manual or automated. For automated processes it may accomplished by the system of record reaching out through another system's API or information may be sent to the system of record. This value set defines a set of codes to describing the process, the how, a resource or data element is validated.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "manual"
          },
          {
            "code" : "portal"
          },
          {
            "code" : "pull"
          },
          {
            "code" : "push"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-primarysourcetype" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Validation Type

This value set defines a set of codes that describes the entity that provides validatation of attested data.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcetype",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.593Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Validation Type</h2><div><p>This value set defines a set of codes that describes the entity that provides validatation of attested data.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-licenseboard\">licenseboard</a></td><td>License Board</td><td>License Board</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-primaryed\">primaryed</a></td><td>Primary Education</td><td>Primary Education</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-continuinged\">continuinged</a></td><td>Continuing Education</td><td>Continuing Education</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-postalservice\">postalservice</a></td><td>Postal Service</td><td>Postal Service</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-relowner\">relowner</a></td><td>Relationship owner</td><td>Relationship owner</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-regauth\">regauth</a></td><td>Registration Authority</td><td>Registration Authority</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-legalsource\">legalsource</a></td><td>Legal source</td><td>Legal source</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-issuingsource\">issuingsource</a></td><td>Issuing source</td><td>Issuing source</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-attester\">attester</a></td><td>Attester</td><td>Attester</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcetype",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourceType",
  "title" : "VhDir Primary Source Validation Type",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that describes the entity that provides validatation of attested data.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "licenseboard"
          },
          {
            "code" : "primaryed"
          },
          {
            "code" : "continuinged"
          },
          {
            "code" : "postalservice"
          },
          {
            "code" : "relowner"
          },
          {
            "code" : "regauth"
          },
          {
            "code" : "legalsource"
          },
          {
            "code" : "issuingsource"
          },
          {
            "code" : "attester"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-primarysourcepushtype" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Push Type

This value set defines a set of codes that indicate the scope of data sent from a primary source of validated data to a validated healthcare directory when there is a push model (from the sender) for sending data.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    specificSpecific requested changesThe sender will send specific changes to the healthcare directory as determined by agreement.
    anyAny changesThe sender will send all changes to the healthcare directory.
    sourcedefAs defined by the source/senderThe sender will only send changes they have determined to be significant.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcepushtype",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.546Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Push Type</h2><div><p>This value set defines a set of codes that indicate the scope of data sent from a primary source of validated data to a validated healthcare directory when there is a push model (from the sender) for sending data.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-specific\">specific</a></td><td>Specific requested changes</td><td>The sender will send specific changes to the healthcare directory as determined by agreement.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-any\">any</a></td><td>Any changes</td><td>The sender will send all changes to the healthcare directory.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-sourcedef\">sourcedef</a></td><td>As defined by the source/sender</td><td>The sender will only send changes they have determined to be significant.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcepushtype",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourcePushType",
  "title" : "VhDir Primary Source Push Type",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate the scope of data sent from a primary source of validated data to a validated healthcare directory when there is a push model (from the sender) for sending data.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "specific"
          },
          {
            "code" : "any"
          },
          {
            "code" : "sourcedef"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-primarysourcepush" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Push

This value set defines a set of codes that indicate if a primary source of validated data has the capacity to send validation details directly to a validated healthcare directory.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    pushyesYesThe primary source validation can be achieved via a push of data from the source of that information.
    pushnoNoThe primary source validation cannot be achieved via a push of data from the source of that information.
    pushundeterminedUndeterminedIt is if undetermined if primary source validation can be achieved via a push of data from the source of that information.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcepush",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.484Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Push</h2><div><p>This value set defines a set of codes that indicate if a primary source of validated data has the capacity to send validation details directly to a validated healthcare directory.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-pushyes\">pushyes</a></td><td>Yes</td><td>The primary source validation can be achieved via a push of data from the source of that information.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-pushno\">pushno</a></td><td>No</td><td>The primary source validation cannot be achieved via a push of data from the source of that information.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-pushundetermined\">pushundetermined</a></td><td>Undetermined</td><td>It is if undetermined if primary source validation can be achieved via a push of data from the source of that information.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcepush",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourcePush",
  "title" : "VhDir Primary Source Push",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate if a primary source of validated data has the capacity to send validation details directly to a validated healthcare directory.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "pushyes"
          },
          {
            "code" : "pushno"
          },
          {
            "code" : "pushundetermined"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-primarysourcefailureaction" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Primary Source Failure Action

This value set defines a set of codes that indicate the disposition of a primary source validation process that has failed.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation
    CodeDisplay
    fatalFatalA failure that is likely relevant to local workflow environments, considered sufficient to suspend the resource/element and one or more action has been taken.
    warningWarningA failure that may be relevant to some local workflow environments, but in and of itself is not consider sufficient to suspend the resource/element. E.g. validating membership in an organization.
    recordonlyRecord onlyA failure that may be relevant to some local workflow environments and will be documented but not result in notification or publication of the error.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-primarysourcefailureaction",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.437Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Primary Source Failure Action</h2><div><p>This value set defines a set of codes that indicate the disposition of a primary source validation process that has failed.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-validation.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-fatal\">fatal</a></td><td>Fatal</td><td>A failure that is likely relevant to local workflow environments, considered sufficient to suspend the resource/element and one or more action has been taken.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-warning\">warning</a></td><td>Warning</td><td>A failure that may be relevant to some local workflow environments, but in and of itself is not consider sufficient to suspend the resource/element. E.g. validating membership in an organization.</td></tr><tr><td><a href=\"CodeSystem-codesystem-validation.html#codesystem-validation-recordonly\">recordonly</a></td><td>Record only</td><td>A failure that may be relevant to some local workflow environments and will be documented but not result in notification or publication of the error.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-primarysourcefailureaction",
  "version" : "0.2.0",
  "name" : "VhDirPrimarySourceFailureAction",
  "title" : "VhDir Primary Source Failure Action",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate the disposition of a primary source validation process that has failed.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-validation",
        "concept" : [
          {
            "code" : "fatal"
          },
          {
            "code" : "warning"
          },
          {
            "code" : "recordonly"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-plan-type" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Plan Type

This value set defines a set of codes that indicate the type of a plan.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics
    CodeDisplay
    catCatastrophic'Catastrophic' health insurance plans have low monthly premiums and very high deductibles. They may cover worst-case scenarios, like getting seriously sick or injured. Patient pays most routine medical expenses.
    bronzeBronze'Bronze' type plan defines the estimated split costs of the plan, where patient is responsible for 40% of their healthcare cost while 60% is covered by the plan.
    bronzeexpExpanded BronzeThe 'extended bronze' plan is an addition to the bronze metal level which establishes the de minimis variation range for the actuarial value (AV) level of coverage to allow variation in the AV to -4/+2 percentage points.
    silverSilver'Silver' type plan defines the estimated split costs of the plan, where patient is responsible for 30% of their healthcare cost while 70% is covered by the plan.
    goldGold'Gold' type plan defines the estimated split costs of the plan, where patient is responsible for 20% of their healthcare cost while 80% is covered by the plan.
    platinumPlatinum'Platinum' type plan defines the estimated split costs of the plan, where patient is responsible for 10% of their healthcare cost while 90% is covered by the plan.
    lowdedLow deductibleA health insurance plan with higher premiums and lower out of pocket cost than a traditional health plan.
    highdedHigh deductibleA health insurance plan with lower premiums and higher out of pocket cost than a traditional health plan.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-plan-type",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.374Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Plan Type</h2><div><p>This value set defines a set of codes that indicate the type of a plan.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-payercharacteristics.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-cat\">cat</a></td><td>Catastrophic</td><td>'Catastrophic' health insurance plans have low monthly premiums and very high deductibles. They may cover worst-case scenarios, like getting seriously sick or injured. Patient pays most routine medical expenses.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-bronze\">bronze</a></td><td>Bronze</td><td>'Bronze' type plan defines the estimated split costs of the plan, where patient is responsible for 40% of their healthcare cost while 60% is covered by the plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-bronzeexp\">bronzeexp</a></td><td>Expanded Bronze</td><td>The 'extended bronze' plan is an addition to the bronze metal level which establishes the de minimis variation range for the actuarial value (AV) level of coverage to allow variation in the AV to -4/+2 percentage points.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-silver\">silver</a></td><td>Silver</td><td>'Silver' type plan defines the estimated split costs of the plan, where patient is responsible for 30% of their healthcare cost while 70% is covered by the plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-gold\">gold</a></td><td>Gold</td><td>'Gold' type plan defines the estimated split costs of the plan, where patient is responsible for 20% of their healthcare cost while 80% is covered by the plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-platinum\">platinum</a></td><td>Platinum</td><td>'Platinum' type plan defines the estimated split costs of the plan, where patient is responsible for 10% of their healthcare cost while 90% is covered by the plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-lowded\">lowded</a></td><td>Low deductible</td><td>A health insurance plan with higher premiums and lower out of pocket cost than a traditional health plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-highded\">highded</a></td><td>High deductible</td><td>A health insurance plan with lower premiums and higher out of pocket cost than a traditional health plan.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-plan-type",
  "version" : "0.2.0",
  "name" : "VhDirPlanType",
  "title" : "VhDir Plan Type",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate the type of a plan.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics",
        "concept" : [
          {
            "code" : "cat"
          },
          {
            "code" : "bronze"
          },
          {
            "code" : "bronzeexp"
          },
          {
            "code" : "silver"
          },
          {
            "code" : "gold"
          },
          {
            "code" : "platinum"
          },
          {
            "code" : "lowded"
          },
          {
            "code" : "highded"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-patientaccess" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Ehr Patient Access Value Set

Codes for documenting patient facing access to an electronic health record system.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-ehrcharacteristics
    CodeDisplay
    portalpatient portalA patient portal is a secure online website that gives patients convenient, 24-hour access to personal health information from anywhere with an Internet connection
    messagingsecure messagingEHR functionality that enables a user to send messages to, and receive messages from, a patient in a secure manner
    VDTview/download/transmit (VDT)EHR functionality that enables patients (and their authorized representatives) to use internet-based technology to view, download, and transmit their health information to a 3rd party.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-patientaccess",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.327Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Ehr Patient Access Value Set</h2><div><p>Codes for documenting patient facing access to an electronic health record system.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-ehrcharacteristics.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-ehrcharacteristics</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-ehrcharacteristics.html#codesystem-ehrcharacteristics-portal\">portal</a></td><td>patient portal</td><td>A patient portal is a secure online website that gives patients convenient, 24-hour access to personal health information from anywhere with an Internet connection</td></tr><tr><td><a href=\"CodeSystem-codesystem-ehrcharacteristics.html#codesystem-ehrcharacteristics-messaging\">messaging</a></td><td>secure messaging</td><td>EHR functionality that enables a user to send messages to, and receive messages from, a patient in a secure manner</td></tr><tr><td><a href=\"CodeSystem-codesystem-ehrcharacteristics.html#codesystem-ehrcharacteristics-VDT\">VDT</a></td><td>view/download/transmit (VDT)</td><td>EHR functionality that enables patients (and their authorized representatives) to use internet-based technology to view, download, and transmit their health information to a 3rd party.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-patientaccess",
  "version" : "0.2.0",
  "name" : "VhDirEHRPatientAccess",
  "title" : "VhDir Ehr Patient Access Value Set",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for documenting patient facing access to an electronic health record system.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-ehrcharacteristics",
        "concept" : [
          {
            "code" : "portal"
          },
          {
            "code" : "messaging"
          },
          {
            "code" : "VDT"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-network-type" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Network Type Value Set

Codes for documenting network type.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-network-type",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.281Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Network Type Value Set</h2><div><p>Codes for documenting network type.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <a href=\"CodeSystem-codesystem-network-type.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-network-type</code></a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-network-type",
  "version" : "0.2.0",
  "name" : "VhDirNetworkType",
  "title" : "VhDir Network Type Value Set",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for documenting network type.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-network-type"
      }
    ]
  }
}

ValueSet "valueset-limit-unit" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Limit Unit

This value set defines a set of codes that indicates the unit of any limit on a benefit in a product/plan.

This value set includes codes from the following code systems:

  • Include these codes as defined in http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics
    CodeDisplay
    daysDaysMeasure of service covered by the plan benefit expressed in a definite number of days.
    visitVisitsMeasure of service covered by the plan benefit expressed in a definite number of visits.
    procedureProceduresMeasure of service covered by the plan benefit expressed in a set of actions covered.
    admissionAdmissionsMeasure of services covered by the benefit plan expressed in relation to patient's acceptance for medical and nursing care in a hospital or other health care institution.
    visithrsHours per visitMeasure expresses how many hours per visit are covered by the insurance benefit plan.
    weekhrsHours per weekMeasure expresses how many hours per week are covered by the insurance benefit plan.
    mthhrsHours per monthMeasure expressed how many hours per month are covered by the insurance benefit plan.
    yrhrsHours per yearMeasure expreses how many hours per year are covered by the insurance benfit plan.
    daysperwkDays per weekMeasure of service covered by the plan benefit expressed in a how many days are covered in a week.
    dayspermthDays per monthMeasure of service covered by the plan benefit expressed in a how many days are covered in a month.
    daysperyrDays per yearMeasure of service covered by the plan benefit expressed in a how many days are covered in a year.
    mthsperyrMonths per yearMeasure of service covered by the plan benefit expressed in a how many month are covered in a year.
    visitsperdayVisits per dayMeasure of service covered by the plan benefit expressed in a definite number of visits covered per day.
    visitsperweekVisits per weekMeasure of service covered by the plan benefit expressed in a definite number of visits covered per week.
    visitspermthVisits per monthMeasure of service covered by the plan benefit expressed in a definite number of visits covered per month.
    visitsperyrVisits per yearMeasure of service covered by the plan benefit expressed in a definite number of visits covered per year.
    lifetimevisitsLifetime visitsMeasure of service covered by the plan benefit expressed in a definite number of visits covered through lifetime.
    txperweekTreatments per weekMeasure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a week.
    txpermnthTreatments per monthMeasure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a month.
    txlifetimeLifetime treatmentsMeasure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a lifetime.
    admitslifetimeLifetime admissionsMeasure of service covered by the plan benefit expressed in a definite number admission actions covered through lifetime.
    procperwkProcedures per weekMeasure of service covered by the plan benefit expressed in a definite number procedure covered per week.
    procpermnthProcedures per monthMeasure of service covered by the plan benefit expressed in a definite number procedure covered per month.
    procperyrProcedures per yearMeasure of service covered by the plan benefit expressed in a definite number procedure covered per year.
    proclifetimeLifetime proceduresMeasure of service covered by the plan benefit expressed in a definite number procedure covered per lifetime.
    daysperadmissionDays per admissionMeasure of service covered by the plan benefit expressed in a definite number of days covered for each individual admission.
    procperepiProcedures per episodeMeasure of service covered by the plan benefit expressed in a definite number of procedures covered for each individual treatment episode.

{
  "resourceType" : "ValueSet",
  "id" : "valueset-limit-unit",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.202Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Limit Unit</h2><div><p>This value set defines a set of codes that indicates the unit of any limit on a benefit in a product/plan.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-payercharacteristics.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-days\">days</a></td><td>Days</td><td>Measure of service covered by the plan benefit expressed in a definite number of days.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visit\">visit</a></td><td>Visits</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-procedure\">procedure</a></td><td>Procedures</td><td>Measure of service covered by the plan benefit expressed in a set of actions covered.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-admission\">admission</a></td><td>Admissions</td><td>Measure of services covered by the benefit plan expressed in relation to patient's acceptance for medical and nursing care in a hospital or other health care institution.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visithrs\">visithrs</a></td><td>Hours per visit</td><td>Measure expresses how many hours per visit are covered by the insurance benefit plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-weekhrs\">weekhrs</a></td><td>Hours per week</td><td>Measure expresses how many hours per week are covered by the insurance benefit plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-mthhrs\">mthhrs</a></td><td>Hours per month</td><td>Measure expressed how many hours per month are covered by the insurance benefit plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-yrhrs\">yrhrs</a></td><td>Hours per year</td><td>Measure expreses how many hours per year are covered by the insurance benfit plan.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-daysperwk\">daysperwk</a></td><td>Days per week</td><td>Measure of service covered by the plan benefit expressed in a how many days are covered in a week.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-dayspermth\">dayspermth</a></td><td>Days per month</td><td>Measure of service covered by the plan benefit expressed in a how many days are covered in a month.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-daysperyr\">daysperyr</a></td><td>Days per year</td><td>Measure of service covered by the plan benefit expressed in a how many days are covered in a year.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-mthsperyr\">mthsperyr</a></td><td>Months per year</td><td>Measure of service covered by the plan benefit expressed in a how many month are covered in a year.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visitsperday\">visitsperday</a></td><td>Visits per day</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits covered per day.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visitsperweek\">visitsperweek</a></td><td>Visits per week</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits covered per week.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visitspermth\">visitspermth</a></td><td>Visits per month</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits covered per month.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-visitsperyr\">visitsperyr</a></td><td>Visits per year</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits covered per year.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-lifetimevisits\">lifetimevisits</a></td><td>Lifetime visits</td><td>Measure of service covered by the plan benefit expressed in a definite number of visits covered through lifetime.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-txperweek\">txperweek</a></td><td>Treatments per week</td><td>Measure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a week.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-txpermnth\">txpermnth</a></td><td>Treatments per month</td><td>Measure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a month.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-txlifetime\">txlifetime</a></td><td>Lifetime treatments</td><td>Measure of service covered by the plan benefit expressed in a definite number of treatment actions covered in a lifetime.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-admitslifetime\">admitslifetime</a></td><td>Lifetime admissions</td><td>Measure of service covered by the plan benefit expressed in a definite number admission actions covered through lifetime.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-procperwk\">procperwk</a></td><td>Procedures per week</td><td>Measure of service covered by the plan benefit expressed in a definite number procedure covered per week.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-procpermnth\">procpermnth</a></td><td>Procedures per month</td><td>Measure of service covered by the plan benefit expressed in a definite number procedure covered per month.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-procperyr\">procperyr</a></td><td>Procedures per year</td><td>Measure of service covered by the plan benefit expressed in a definite number procedure covered per year.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-proclifetime\">proclifetime</a></td><td>Lifetime procedures</td><td>Measure of service covered by the plan benefit expressed in a definite number procedure covered per lifetime.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-daysperadmission\">daysperadmission</a></td><td>Days per admission</td><td>Measure of service covered by the plan benefit expressed in a definite number of days covered for each individual admission.</td></tr><tr><td><a href=\"CodeSystem-codesystem-payercharacteristics.html#codesystem-payercharacteristics-procperepi\">procperepi</a></td><td>Procedures per episode</td><td>Measure of service covered by the plan benefit expressed in a definite number of procedures covered for each individual treatment episode.</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-limit-unit",
  "version" : "0.2.0",
  "name" : "VhDirLimitUnit",
  "title" : "VhDir Limit Unit",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicates the unit of any limit on a benefit in a product/plan.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-payercharacteristics",
        "concept" : [
          {
            "code" : "days"
          },
          {
            "code" : "visit"
          },
          {
            "code" : "procedure"
          },
          {
            "code" : "admission"
          },
          {
            "code" : "visithrs"
          },
          {
            "code" : "weekhrs"
          },
          {
            "code" : "mthhrs"
          },
          {
            "code" : "yrhrs"
          },
          {
            "code" : "daysperwk"
          },
          {
            "code" : "dayspermth"
          },
          {
            "code" : "daysperyr"
          },
          {
            "code" : "mthsperyr"
          },
          {
            "code" : "visitsperday"
          },
          {
            "code" : "visitsperweek"
          },
          {
            "code" : "visitspermth"
          },
          {
            "code" : "visitsperyr"
          },
          {
            "code" : "lifetimevisits"
          },
          {
            "code" : "txperweek"
          },
          {
            "code" : "txpermnth"
          },
          {
            "code" : "txlifetime"
          },
          {
            "code" : "admitslifetime"
          },
          {
            "code" : "procperwk"
          },
          {
            "code" : "procpermnth"
          },
          {
            "code" : "procperyr"
          },
          {
            "code" : "proclifetime"
          },
          {
            "code" : "daysperadmission"
          },
          {
            "code" : "procperepi"
          }
        ]
      }
    ]
  }
}

ValueSet "valueset-languageproficiency" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Spoken Language Proficiency

Codes for documenting spoken language proficiency based on the Interagency Language Roundtable scale of abilities to communicate in a language.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-languageproficiency",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.156Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Spoken Language Proficiency</h2><div><p>Codes for documenting spoken language proficiency based on the Interagency Language Roundtable scale of abilities to communicate in a language.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include all codes defined in <a href=\"CodeSystem-codesystem-languageproficiency.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-languageproficiency</code></a></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-languageproficiency",
  "version" : "0.2.0",
  "name" : "VhDirSpokenLanguageProficiency",
  "title" : "VhDir Spoken Language Proficiency",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "Codes for documenting spoken language proficiency based on the Interagency Language Roundtable scale of abilities to communicate in a language.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-languageproficiency"
      }
    ]
  }
}

ValueSet "valueset-insuranceplangroupsize" Version "1"

Tags: (no tags)  +

This Resource , XML or JSON representation, or the full version history.. provenance for this resource
Updated: by

VhDir Insurance Plan Group Size

This value set defines a set of codes that indicate the size of coverage.

This value set includes codes from the following code systems:


{
  "resourceType" : "ValueSet",
  "id" : "valueset-insuranceplangroupsize",
  "meta" : {
    "versionId" : "1",
    "lastUpdated" : "2018-09-06T12:55:38.093Z"
  },
  "text" : {
    "status" : "generated",
    "div" : "<div xmlns=\"http://www.w3.org/1999/xhtml\"><h2>VhDir Insurance Plan Group Size</h2><div><p>This value set defines a set of codes that indicate the size of coverage.</p>\n</div><p>This value set includes codes from the following code systems:</p><ul><li>Include these codes as defined in <a href=\"CodeSystem-codesystem-insuranceplan.html\"><code>http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-insuranceplan</code></a><table class=\"none\"><tr><td style=\"white-space:nowrap\"><b>Code</b></td><td><b>Display</b></td></tr><tr><td><a href=\"CodeSystem-codesystem-insuranceplan.html#codesystem-insuranceplan-self\">self</a></td><td>Self</td><td>Self</td></tr><tr><td><a href=\"CodeSystem-codesystem-insuranceplan.html#codesystem-insuranceplan-selfplusone\">selfplusone</a></td><td>Self plus one</td><td>Self plus one</td></tr><tr><td><a href=\"CodeSystem-codesystem-insuranceplan.html#codesystem-insuranceplan-selfandfamily\">selfandfamily</a></td><td>Self and family</td><td>Self and family</td></tr></table></li></ul></div>"
  },
  "url" : "http://hl7.org/fhir/uv/vhdir/ValueSet/valueset-insuranceplangroupsize",
  "version" : "0.2.0",
  "name" : "VhDirInsPlanGroupSize",
  "title" : "VhDir Insurance Plan Group Size",
  "status" : "active",
  "date" : "2018-02-21",
  "publisher" : "HL7 International",
  "contact" : [
    {
      "telecom" : [
        {
          "system" : "other",
          "value" : "http://hl7.org/fhir"
        }
      ]
    }
  ],
  "description" : "This value set defines a set of codes that indicate the size of coverage.",
  "compose" : {
    "include" : [
      {
        "system" : "http://hl7.org/fhir/uv/vhdir/CodeSystem/codesystem-insuranceplan",
        "concept" : [
          {
            "code" : "self"
          },
          {
            "code" : "selfplusone"
          },
          {
            "code" : "selfandfamily"
          }
        ]
      }
    ]
  }
}